KEGG   Bacillus subtilis subsp. subtilis 168: BSU39640
Entry
BSU39640          CDS       T00010                                 

Symbol
yxdL
Name
(RefSeq) ABC transporter ATP-binding protein
  KO
K11635  putative ABC transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU39640 (yxdL)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39640 (yxdL)
Transporters [BR:bsu02000]
 ABC transporters, prokaryotic type
  ABC-2 type and other transporters
   Uncharacterized ABC transporter
    BSU39640 (yxdL)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 RsgA_GTPase AAA_22 AAA_23 AAA_16 AAA_30 AAA_25 ATPase_2 T2SSE cobW AAA_11 AAA_15
Other DBs
NCBI-GeneID: 937596
NCBI-ProteinID: NP_391843
Pasteur: BG11128
BSORF: BG11128
UniProt: P42423 A0A6M4JQU5
Position
complement(4070393..4071166)
AA seq 257 aa
MANMLEVKHINKTYKGQVSYQALKQISFSIEEGEFTAVMGPSGSGKTTLLNIISTIDRPD
SGDILINGENPHRLKRTKLAHFRRKQLGFVFQDFNLLDTLTIGENIMLPLTLEKEAPSVM
EEKLHGIAAKLGIENLLNKRTFEVSGGQRQRAAIARAVIHKPSLILADEPTGNLDSKATK
DVMETLQSLNRDDHVTALMVTHDPVSASYCRRVIFIKDGELFNEIYRGENRQVFYEQILD
VLSMLGGNANDLSSVRL
NT seq 774 nt   +upstreamnt  +downstreamnt
atggcgaatatgcttgaagtcaaacatataaataaaacctataaaggacaagtgtcctat
caggccttaaagcaaatttcattttcaatagaagaaggcgagttcacggcggtgatgggg
ccgtccgggtccggaaaaacaacgcttttgaatatcatttcaacgattgaccgtccagat
tcaggcgatatcctgattaacggagaaaacccgcatcgcctgaagcggacaaagctcgct
catttccgccgcaagcagctcggatttgtgtttcaggatttcaaccttctggatacgctg
acgatcggtgaaaatatcatgctgccgttaacgcttgaaaaagaagcgccgtctgtaatg
gaagaaaaactgcacggcatcgcggcaaagctcggtatcgaaaacctgcttaacaagcgg
acgtttgaagtatccggaggccagcgccagcgggccgccatcgcaagagcggtcattcat
aagccgtcactcattctggccgatgaaccaactggaaaccttgattccaaagcgacaaaa
gacgtcatggaaacgttgcagagcctgaatcgggatgatcatgtcacggctttgatggtg
acccacgatccggtttcggcaagctactgccgccgcgtcatctttataaaagacggcgaa
ctgtttaatgagatttaccgcggggaaaaccgccaagtattttatgaacaaattctcgat
gtgctgtctatgctggggggaaacgcaaatgacctttcttcagttcgcttataa

DBGET integrated database retrieval system