KEGG   Bacillus subtilis subsp. subtilis 168: BSU39650
Entry
BSU39650          CDS       T00010                                 

Gene name
yxdK
Definition
(RefSeq) sensor histidine kinase
  KO
K11633  two-component system, OmpR family, sensor histidine kinase YxdK [EC:2.7.13.3]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU39650 (yxdK)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:bsu01001]
    BSU39650 (yxdK)
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU39650 (yxdK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     BSU39650 (yxdK)
Protein kinases [BR:bsu01001]
 Histidine kinases
  OmpR family
   BSU39650 (yxdK)
Two-component system [BR:bsu02022]
 OmpR family
  YxdK-YxdJ (antimicrobial peptide response)
   BSU39650 (yxdK)
SSDB
Motif
Pfam: HATPase_c HATPase_c_2 T4_Gp59_C HATPase_c_3 HisKA YlaC
Other DBs
NCBI-GeneID: 937487
NCBI-ProteinID: NP_391844
Pasteur: BG11127
BSORF: BG11127
UniProt: P42422 A0A6M4JQZ4
Position
complement(4071310..4072287)
AA seq 325 aa
MKLFLRSHAVLILLFLLQGLFVFFYYWFAGLHSFSHLFYILGVQLLILAGYLAYRWYKDR
GVYHWLSSGQEGTDIPYLGSSVFCSELYEKQMELIRLQHQKLHETEAKLDARVTYMNQWV
HQVKTPLSVINLIIQEEDEPVFEQIKKEVRQIEFGLETLLYSSRLDLFERDFKIEAVSLS
ELLQSVIQSYKRFFIQYRVYPKMNVCDDHQIYTDAKWLKFAIGQVVTNAVKYSAGKSDRL
ELNVFCDEDRTVLEVKDYGVGIPSQDIKRVFDPYYTGENGRRFQESTGIGLHLVKEITDK
LNHTVDISSSPGEGTSVRFSFLTKM
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaagctgtttctccggtctcatgcagtgctgattctgctttttctccttcaagggctg
tttgtcttcttttattactggtttgcgggtcttcattctttttctcacttgttttacata
ttgggcgtgcagcttcttattttggcgggctatcttgcctatcgctggtacaaagaccgc
ggcgtgtatcattggctcagctcggggcaggaagggacggatatcccgtatctcggttct
tcagtgttctgttcagagctgtatgaaaagcagatggagctgatccggctgcagcaccag
aagctccatgagaccgaagccaagcttgacgcgcgggtgacgtatatgaatcaatgggtg
caccaagtaaagacgccgctgtcggtcattaatttaatcattcaagaagaggatgagccc
gtttttgaacaaatcaaaaaagaagtccggcagattgaattcgggctggagacgcttctt
tattcttcaaggctcgacctgtttgaacgggattttaaaatcgaagcggtttccctgtcc
gagcttctccaatcagttattcaaagctataaacgattttttattcaatatcgcgtttat
ccgaaaatgaacgtttgcgatgatcatcagatttacaccgatgccaaatggctcaaattt
gcgattggccaagtggtcacaaatgcggtcaagtattcagcgggcaagagtgacagactt
gagctgaatgtcttctgcgatgaagacaggacggtgcttgaagtcaaagattacggtgtc
gggattccctcacaagacatcaagcgggtgtttgacccttattacacgggtgaaaacggg
cggcgtttccaagaatctacgggaatcggcctccatctcgtcaaagaaattacagataag
ctcaatcatacggtggacatcagctcgtctcccggtgaagggacatcagttcgattttca
tttcttacaaaaatgtaa

DBGET integrated database retrieval system