KEGG   Bacillus subtilis subsp. subtilis 168: BSU39660
Entry
BSU39660          CDS       T00010                                 

Symbol
yxdJ
Name
(RefSeq) transcriptional regulator
  KO
K11634  two-component system, OmpR family, response regulator YxdJ
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    BSU39660 (yxdJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:bsu02022]
    BSU39660 (yxdJ)
Two-component system [BR:bsu02022]
 OmpR family
  YxdK-YxdJ (antimicrobial peptide response)
   BSU39660 (yxdJ)
SSDB
Motif
Pfam: Response_reg Trans_reg_C KH_5 T2SSE
Other DBs
NCBI-GeneID: 937599
NCBI-ProteinID: NP_391845
Pasteur: BG11126
BSORF: BG11126
UniProt: P42421
Position
complement(4072284..4072973)
AA seq 229 aa
MNKIMIVEDSEDIRGLLQNYLEKYGYQTVVAADFTAVLDVFLREKPDVVLLDINLPAYDG
YYWCRQIRQHSTSPIIFISARSGEMDQVMAIENGGDDYIEKPFSYDIVLAKIKSQIRRAY
GEYAAKQGEKVVEYAGVQLFVERFELRFQDEKSELSKKESKLLEVLLERGEKVTSRDRLM
EKTWDTDIFIDDNTLNVYITRLRKKLRELNAPVSIEAVRGEGYQLRAQS
NT seq 690 nt   +upstreamnt  +downstreamnt
ttgaataaaatcatgattgtggaagacagtgaagacattcgcggactattgcagaattac
cttgaaaaatacggatatcaaacagtggtcgccgcggattttacagctgttcttgatgtc
tttttgcgggaaaagcccgatgtggtgctgcttgatatcaatttgccggcatatgacgga
tattattggtgccggcagatccgccagcactccacaagcccgatcatctttatttctgcc
agaagcggggaaatggatcaggtgatggcgattgaaaatgggggagacgattatatcgaa
aaaccgttttcttatgatattgtgcttgcgaaaatcaaaagccagatccggagggcgtac
ggggagtacgccgcaaagcagggagagaaagtggttgaatatgccggcgttcagctcttt
gtggaacggtttgaactgcgttttcaggatgaaaaaagtgagctttctaaaaaagaaagc
aagcttttggaagtgctgcttgagcggggagaaaaggtgacgagtcgggaccgtctcatg
gaaaagacgtgggacaccgacatattcatcgatgataatacacttaacgtgtatatcacg
cggctcagaaaaaaactgcgggagctgaatgcgcctgtttctattgaagcggtgcggggc
gaaggctaccagctgagggcgcagtcatga

DBGET integrated database retrieval system