KEGG   Bacillus subtilis subsp. subtilis 168: BSU39670Help
Entry
BSU39670          CDS       T00010                                 

Gene name
iolJ
Definition
(RefSeq) 6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase
  KO
K03339  6-phospho-5-dehydro-2-deoxy-D-gluconate aldolase [EC:4.1.2.29]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU39670 (iolJ)
Enzymes [BR:bsu01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.29  5-dehydro-2-deoxyphosphogluconate aldolase
     BSU39670 (iolJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: F_bP_aldolase UvrA_inter
Motif
Other DBs
NCBI-GeneID: 937601
NCBI-ProteinID: NP_391846
Pasteur: BG11125
BSORF: BG11125
UniProt: P42420
Position
complement(4073081..4073953)
Genome map
AA seq 290 aa AA seqDB search
MAFVSMKELLEDAKREQYAIGQFNINGLQWTKAILQAAQKEQSPVIAAASDRLVDYLGGF
KTIAAMVGALIEDMAITVPVVLHLDHGSSAERCRQAIDAGFSSVMIDGSHQPIDENIAMT
KEVTDYAAKHGVSVEAEVGTVGGMEDGLVGGVRYADITECERIVKETNIDALAAALGSVH
GKYQGEPNLGFKEMEAISRMTDIPLVLHGASGIPQDQIKKAITLGHAKININTECMVAWT
DETRRMFQENSDLYEPRGYLTPGIEAVEETVRSKMREFGSAGKAAKQQVG
NT seq 873 nt NT seq  +upstreamnt  +downstreamnt
atggcttttgtatcgatgaaagagcttcttgaagatgcaaagcgggagcaatatgcaatt
ggccagtttaatatcaacggcctgcaatggacgaaggcgattttgcaggcggcgcaaaag
gagcaatcaccggtcatcgccgcggcttccgatcgcctggtcgactatttaggcggattt
aaaacgattgccgccatggtcggcgcgttaatagaggacatggcgattaccgttccggtc
gtgcttcatctcgatcacggcagcagtgcggaacgctgcagacaggccattgatgccgga
ttcagctcagtgatgattgacggctcccatcagccgattgacgagaatatcgcgatgaca
aaagaagtcaccgattatgccgcaaaacacggcgtgtcagtagaagccgaagtcggcacg
gtcggcggaatggaagacggactggtcggcggggtccgctatgcggatatcacggaatgt
gagcggatcgttaaagaaaccaatatcgacgcgctggccgccgccctcggctctgtacac
ggcaaatatcagggtgagccgaatctcggatttaaggaaatggaggctatctcccgcatg
actgatattcccctcgttcttcacggggcatccgggattccgcaggatcagatcaaaaaa
gccatcacgctcggccacgcgaagatcaatatcaatacggaatgtatggtagcgtggaca
gacgaaacacgccgcatgtttcaggaaaacagcgatctgtacgaaccgcgcggctatttg
acacccggcattgaagccgtggaagagacagtgcgaagcaaaatgagagagttcggatca
gccggtaaagcagctaagcagcaggtcggctaa

DBGET integrated database retrieval system