KEGG   Bacillus subtilis subsp. subtilis 168: BSU39680
Entry
BSU39680          CDS       T00010                                 

Symbol
iolI
Name
(RefSeq) inosose isomerase
  KO
K06606  2-keto-myo-inositol isomerase [EC:5.3.99.11]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU39680 (iolI)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.99  Other intramolecular oxidoreductases
    5.3.99.11  2-keto-myo-inositol isomerase
     BSU39680 (iolI)
SSDB
Motif
Pfam: AP_endonuc_2 ADH_zinc_N ASK_PH
Other DBs
NCBI-GeneID: 937582
NCBI-ProteinID: NP_391847
Pasteur: BG11124
BSORF: BG11124
UniProt: P42419 A0A6M3ZHT3
Structure
Position
complement(4073974..4074810)
AA seq 278 aa
MKLCFNEATTLENSNLKLDLELCEKHGYDYIEIRTMDKLPEYLKDHSLDDLAEYFQTHHI
KPLALNALVFFNNRDEKGHNEIITEFKGMMETCKTLGVKYVVAVPLVTEQKIVKEEIKKS
SVDVLTELSDIAEPYGVKIALEFVGHPQCTVNTFEQAYEIVNTVNRDNVGLVLDSFHFHA
MGSNIESLKQADGKKIFIYHIDDTEDFPIGFLTDEDRVWPGQGAIDLDAHLSALKEIGFS
DVVSVELFRPEYYKLTAEEAIQTAKKTTVDVVSKYFSM
NT seq 837 nt   +upstreamnt  +downstreamnt
atgaaactttgttttaatgaagcgacaacattggaaaactcaaaccttaaactggattta
gaactatgcgaaaagcatggctatgattatattgaaatccgtactatggataagctgccg
gagtacttaaaagatcattcattggatgaccttgcggaatattttcaaacccaccacatc
aaaccgcttgccttaaacgcactcgttttcttcaacaaccgtgatgaaaagggtcacaac
gagatcatcactgaatttaaaggcatgatggaaacatgcaaaaccctcggtgtgaaatat
gtggtggccgttccgcttgtgacagagcagaagattgtaaaagaagagatcaaaaagagc
agtgtagacgtgctgactgagctgtcagatatcgcggagccgtacggcgtaaaaatcgcg
cttgagtttgtcggccatccgcaatgtacggtcaatacgtttgaacaggcgtatgagatt
gtaaacacagttaaccgtgacaatgtcgggcttgtccttgacagttttcacttccatgca
atgggttcaaatattgagagcttaaagcaggcggacggaaagaaaatcttcatctatcat
attgatgatacagaagatttcccaatcggctttttaacagatgaggatcgtgtatggccg
ggacaaggggcaattgacttagatgcccacttatcagcactgaaggaaatcggcttctct
gatgttgtttcggttgagctcttccggcctgaatactataagctgactgctgaggaagcc
attcaaacagcgaaaaaaacaacagtggatgtcgtatcaaaatacttcagcatgtaa

DBGET integrated database retrieval system