KEGG   Bacillus subtilis subsp. subtilis 168: BSU39690
Entry
BSU39690          CDS       T00010                                 

Symbol
iolH
Name
(RefSeq) myo-inositol catabolism protein IolH
  KO
K06605  myo-inositol catabolism protein IolH
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99981 Carbohydrate metabolism
    BSU39690 (iolH)
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-GeneID: 937613
NCBI-ProteinID: NP_391848
Pasteur: BG11123
BSORF: BG11123
UniProt: P42418 A0A6M3ZHZ4
Position
complement(4074896..4075765)
AA seq 289 aa
MKLALDPSMYRDDLTLEEMVYKTAELGYEYIELSPREDFCPFYKYPKVDSAKIKQLKRLL
RDTGVKLSSLLPLYHWAGPDEDRRQAAVRNWKRAIEIAVELEVDLMNSEFSGSKYDPLTS
EEKFIKSMDELLPVFEKEGIKLNLQAHPYDFIETHKGAMDMIRALDKDWINLVYSTAHTF
FYDDGKGDIETMFDEAGDRLTHVLFADTYNHKAAHGLRYIVNPPDAKVTVHQHLDIGQGE
VDFDTIFRKLREMKFDGIATNAVFAWVDERADESSRFMLKKMKEELGLA
NT seq 870 nt   +upstreamnt  +downstreamnt
atgaagttagcattggatccatccatgtatcgtgatgatttaactttagaggaaatggtc
tataaaacggcagagctcggctatgaatatatcgaattatcgccgcgcgaggatttttgc
ccgttttataaatatccgaaagtcgattcagcaaagatcaaacaattaaagcgcctttta
agagatacaggtgttaagctttcatcgcttcttcctctttaccactgggcgggacccgat
gaagaccgccgccaggcagcagtgcgcaactggaaacgggcaatcgaaattgcggttgaa
cttgaagtggatttgatgaacagcgaattcagcggttcaaaatatgatcctttaacaagt
gaagaaaaatttatcaaatccatggatgagcttctgccagtctttgaaaaagaaggcatt
aaactcaatcttcaagcccatccatatgattttatcgaaacgcacaaaggtgcgatggat
atgatccgcgcgcttgacaaggattggatcaatcttgtctactcgactgcgcatacgttc
ttctatgatgacggcaaaggcgacatcgagaccatgtttgacgaagccggcgaccgcctc
acacatgttttatttgcagatacctataatcataaagcggctcatggccttcgctacatc
gtcaatccgcctgacgcgaaagtaacggttcaccagcatttggacattggccaaggcgag
gttgattttgatacgattttcagaaaactgagagagatgaagttcgacggaattgcgacg
aatgccgtatttgcttgggtcgatgaaagagcggatgaatcaagccgatttatgcttaag
aaaatgaaagaagaattaggtctggcataa

DBGET integrated database retrieval system