KEGG   Bacillus subtilis subsp. subtilis 168: BSU39700
Entry
BSU39700          CDS       T00010                                 

Symbol
iolG
Name
(RefSeq) inositol 2-dehydrogenase/D-chiro-inositol 3-dehydrogenase
  KO
K00010  myo-inositol 2-dehydrogenase / D-chiro-inositol 1-dehydrogenase [EC:1.1.1.18 1.1.1.369]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00521  Streptomycin biosynthesis
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU39700 (iolG)
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    BSU39700 (iolG)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.18  inositol 2-dehydrogenase
     BSU39700 (iolG)
    1.1.1.369  D-chiro-inositol 1-dehydrogenase
     BSU39700 (iolG)
SSDB
Motif
Pfam: GFO_IDH_MocA_C GFO_IDH_MocA F420_oxidored 2-Hacid_dh_C Shikimate_DH NAD_binding_2 Gp_dh_N
Other DBs
NCBI-GeneID: 937615
NCBI-ProteinID: NP_391849
Pasteur: BG10669
BSORF: BG10669
UniProt: P26935
Structure
Position
complement(4075785..4076819)
AA seq 344 aa
MSLRIGVIGTGAIGKEHINRITNKLSGAEIVAVTDVNQEAAQKVVEQYQLNATVYPNDDS
LLADENVDAVLVTSWGPAHESSVLKAIKAQKYVFCEKPLATTAEGCMRIVEEEIKVGKRL
VQVGFMRRYDSGYVQLKEALDNHVIGEPLMIHCAHRNPTVGDNYTTDMAVVDTLVHEIDV
LHWLVNDDYESVQVIYPKKSKNALPHLKDPQIVVIETKGGIVINAEIYVNCKYGYDIQCE
IVGEDGIIKLPEPSSISLRKEGRFSTDILMDWQRRFVAAYDVEIQDFIDSIQKKGEVSGP
TAWDGYIAAVTTDACVKAQESGQKEKVELKEKPEFYQSFTTVQN
NT seq 1035 nt   +upstreamnt  +downstreamnt
atgagtttacgtattggcgtaattggaactggagcaatcggaaaagaacatattaaccgt
atcacgaacaagctgtcaggcgcggaaattgtagctgtaacggatgttaatcaagaagct
gcacaaaaggtcgttgagcaataccaattaaacgcgacggtttatccgaatgatgacagc
ttgcttgcagacgaaaatgtagacgctgttttagtgacaagctgggggcctgcgcatgag
tcaagcgtgctgaaagcgattaaagcccagaaatatgtgttctgtgaaaaaccgctcgcg
acaacggctgaaggatgcatgcgcattgtcgaagaagaaatcaaagtgggcaaacgcctt
gttcaagtcggcttcatgcgccgttatgacagcggttacgtacagctgaaagaagcgctc
gataatcatgtcatcggcgagcctcttatgattcactgcgcgcaccgcaacccgactgta
ggagataactatacaacggatatggctgtagtcgacacgcttgttcatgaaattgacgtg
ctccactggctcgtcaatgatgactacgagtccgttcaagtcatctatccgaaaaaatca
aaaaacgcgcttccacatttaaaagatccgcaaatcgtcgtgattgaaacaaaaggcggt
atcgtcatcaatgctgaaatctatgtgaactgtaaatacggctatgacattcaatgtgaa
atcgtcggagaagacggcatcatcaagcttcccgagccatcaagcatcagcttgagaaaa
gaaggcagattcagcactgatattttgatggattggcagagacgctttgtcgctgcgtat
gatgtggaaatccaagactttattgattcgattcaaaagaaaggcgaggtcagcggaccg
acggcatgggacggctatattgctgctgtcacgactgacgcgtgtgtaaaagcccaggaa
tctggacaaaaagaaaaggttgaattgaaggaaaaaccggaattctatcaatcttttaca
acagttcaaaactaa

DBGET integrated database retrieval system