KEGG   Bacillus subtilis subsp. subtilis 168: BSU39710
Entry
BSU39710          CDS       T00010                                 

Symbol
iolF
Name
(RefSeq) minor myo-inositol transporter IolF
  KO
K06610  MFS transporter, SP family, inositol transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU39710 (iolF)
Transporters [BR:bsu02000]
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    BSU39710 (iolF)
SSDB
Motif
Pfam: MFS_1 Sugar_tr OAD_gamma
Other DBs
NCBI-GeneID: 937616
NCBI-ProteinID: NP_391850
Pasteur: BG11122
BSORF: BG11122
UniProt: P42417 A0A6M4JQX0
Position
complement(4076842..4078158)
AA seq 438 aa
MGNTNGDSAFNKRTIAAALANYIDAGSIVAGSAGLSLWVSYLKLSDTQIGLLGALSANAI
SAAVGALLGGFLADKVGRKAVYTNSMLVYALGICLVLFGVNFPMLLSGYIIIGLSVGADI
TASWTIIAENAPKKNRARHCGVAQVAWAAGAVVVLLLSVLAGDLGLLGNKIVFAHLLVIA
LITYILRIRLPESDAWQTKNQPEEAQAEKPAVLNKTSYFDLLKPMYLKSILFLMGVYLVW
NLAAGVMGFFMPYIYQQVGGVSANMANLLQMGLFIFTGLGVALIFMPFADKYRKTVFGIA
AFMAVIGWTLFLLPVEGLPILLLFIVVIGINNGAGQQANYQLWASEIFPTQYRASAQGLM
FFLVRISIGIWSLFVPMIITNFGIGTMAAILLGCVTASMIIGLLFAPNTSGKSLEQIQEE
LYGSPQSQVKKGTESKIM
NT seq 1317 nt   +upstreamnt  +downstreamnt
atgggcaataccaatggagattcagccttcaataaacggacaatcgcggcagcattggcc
aactatattgatgccggttcaattgtggcaggctccgccggtttatcattatgggtcagt
taccttaagctatccgatacgcaaatcgggctgctcggcgcgttgagcgcaaatgcgatt
tctgccgctgtcggcgcgctgcttggcgggtttctggctgataaagtcggacggaaggct
gtttataccaatagtatgctggtttatgcactagggatttgtttggttttgttcggggtt
aatttccccatgttgttaagcggttacatcattatcggtttatcagtaggggctgacata
accgcgtcatggaccattattgcggaaaatgcgccaaagaagaatcgggccaggcattgc
ggcgtagcacaagtcgcttgggccgcgggcgctgtcgttgtactgctcctctccgtactg
gccggtgacttgggactcttggggaataaaatcgtatttgcccatctgcttgtgattgcg
ctgattacgtacatcctgagaatcaggcttccggaatcagacgcctggcagacaaaaaat
cagccggaggaagctcaggcagagaagccggctgtattgaataagacatcgtattttgat
ttgctcaagcctatgtatctaaaaagcatcctgtttttgatgggtgtgtacttggtttgg
aacctagccgccggggtcatgggcttctttatgccatacatttatcagcaggtcggcggt
gtatctgccaacatggccaaccttttgcaaatggggctgtttatcttcacaggattgggg
gtcgccttgatcttcatgccctttgccgacaaatatagaaaaaccgtatttggaatcgcc
gctttcatggcggtgatcgggtggacactgtttctgctgccagttgaaggcctgccgatt
ctgctcctgtttattgtcgtgatcggcatcaataacggagccgggcagcaagcgaactat
cagttatgggccagcgaaatctttcctacgcaatatcgtgcttccgcacaaggactgatg
tttttccttgtccgtatttcaatagggatttggagtctgtttgtcccaatgattatcacc
aatttcggcattggaacgatggctgcaattcttctcggatgtgtgacggccagtatgatc
atcgggctgctctttgcgccgaatacgtctggcaagtcgcttgaacaaattcaagaggaa
ctctacgggtctcctcagagccaagtaaagaaaggaacagaaagcaaaatcatgtaa

DBGET integrated database retrieval system