KEGG   Bacillus subtilis subsp. subtilis 168: BSU39720
Entry
BSU39720          CDS       T00010                                 

Symbol
iolE
Name
(RefSeq) inosose dehydratase
  KO
K03335  inosose dehydratase [EC:4.2.1.44]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU39720 (iolE)
Enzymes [BR:bsu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.44  myo-inosose-2 dehydratase
     BSU39720 (iolE)
SSDB
Motif
Pfam: AP_endonuc_2
Other DBs
NCBI-GeneID: 936212
NCBI-ProteinID: NP_391851
Pasteur: BG11121
BSORF: BG11121
UniProt: P42416 A0A6M3ZKG5
Position
complement(4078173..4079066)
AA seq 297 aa
MGKNEILWGIAPIGWRNDDMPEIGAGNTLQHLLSDIVVARFQGTEVGGFFPEPAILNKEL
KLRNLRIAGKWFSSFILRDGLGEAAKTFTLHCEYLQQVNADVAVVSEQTYSVQSLEKNVF
TEKPHFTDDEWERLCEGLNHLGEIAAQHGLKLVYHHHLGTGVQTAEEVDRLMAGTDPAHV
HLLYDTGHAYISDGDYMGMLEKHIGRIKHVHFKDARLNVMEQCRLEGQSFRQSFLKGMFT
VPGDGCIDFREVYQLLLKHSYSGWIVIEAEQDPDVANPLEYALIARNYIDQQLLDLA
NT seq 894 nt   +upstreamnt  +downstreamnt
atgggcaaaaatgaaatcctgtggggaatcgctcccattgggtggcggaatgatgacatg
cctgaaattggagcgggaaatacacttcagcatttgttaagtgatatcgttgtcgcacgt
tttcaaggcacggaggtcgggggctttttccccgaacctgccatcctgaacaaagagctg
aagcttcggaacttacgcattgcaggaaaatggttcagcagttttattttgcgtgacgga
cttggtgaagcggcaaagacatttaccctgcattgtgagtatttgcagcaagtaaacgcg
gatgtcgcagttgtctctgaacaaacgtacagcgtgcaaagcttggagaaaaatgtgttc
acagagaagccgcactttacggatgatgaatgggagcggctttgcgaagggctgaatcac
cttggcgaaattgccgctcagcatggcttgaagcttgtctatcatcatcatctcggcact
ggtgtccaaacagcggaagaagtggaccgcctgatggcaggaacagaccctgcgcatgta
cacctcctctatgatacaggccatgcgtatatttctgacggcgattacatggggatgctt
gagaagcatatcggccgcattaagcatgtgcactttaaggatgcccgcctgaatgtcatg
gaacaatgcaggctcgaaggacaatcgttccggcaatcatttttaaaaggcatgtttacg
gttcccggtgacggctgcattgactttagagaagtatatcagctgctgttgaagcacagt
tattccggatggattgtcattgaagctgaacaagaccccgatgttgcaaacccgctggag
tatgcattgattgcgagaaactatattgatcagcagttgttggatctggcttaa

DBGET integrated database retrieval system