KEGG   Bacillus subtilis subsp. subtilis 168: BSU39740
Entry
BSU39740          CDS       T00010                                 

Symbol
iolC
Name
(RefSeq) 5-dehydro-2-deoxygluconokinase
  KO
K03338  5-dehydro-2-deoxygluconokinase [EC:2.7.1.92]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU39740 (iolC)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.92  5-dehydro-2-deoxygluconokinase
     BSU39740 (iolC)
SSDB
Motif
Pfam: PfkB WIF Phos_pyr_kin Phage_cap_E
Other DBs
NCBI-GeneID: 937622
NCBI-ProteinID: NP_391853
Pasteur: BG11119
BSORF: BG11119
UniProt: P42414 A0A6M4JQV7
Position
complement(4081029..4082006)
AA seq 325 aa
MKYTFNEEKAFDIVAIGRACIDLNAVEYNRPMEETMTFSKYVGGSPANIAIGSAKLGLKA
GFIGKIPDDQHGRFIESYMRKTGVDTTQMIVDQDGHKAGLAFTEILSPEECSILMYRDDV
ADLYLEPSEVSEDYIANAKMLLVSGTALAKSPSREAVLKAVQYAKKHQVKVVFELDYRPY
TWQSSDETAVYYSLVAEQSDIVIGTRDEFDVMENRTGGSNEESVNHLFGHSADLVVIKHG
VEGSYAYSKSGEVFRAQAYKTKVLKTFGAGDSYASAFIYGLVSGKDIETALKYGSASASI
VVSKHSSSEAMPTAEEIEQLIEAQS
NT seq 978 nt   +upstreamnt  +downstreamnt
atgaagtatacattcaatgaagagaaggcttttgatattgttgccatcggccgggcatgt
attgatctgaacgcagtcgaatacaaccgcccaatggaagaaacgatgacattttcgaaa
tatgtcggcggttcacctgcgaatatcgcgatcggcagcgcgaagcttggcttaaaagcg
ggcttcatcggcaaaattccggatgaccagcatggaagattcatagagtcctatatgaga
aagaccggcgtggatactacacagatgattgttgatcaagatggacacaaagcaggcctt
gcatttacagaaatcctcagccctgaagaatgcagcatcttaatgtatcgcgatgatgtg
gcggatctttatcttgagccttcagaggtaagtgaggactatatcgcaaatgcgaaaatg
ctgcttgtctccgggacagcgctcgccaaaagcccgtcacgggaagcggtgttaaaagct
gttcaatacgcgaaaaagcatcaggttaaggtggtattcgaactggattaccggccatat
acgtggcagtcatcagatgaaacagccgtttattattctttggttgccgagcagtctgat
atcgtcatcggcacacgcgatgaatttgatgtgatggaaaaccgcacaggcggaagcaat
gaagaatccgtcaatcatttatttggccattcagccgacctcgttgtcatcaaacacggc
gtcgaaggctcttacgcatacagcaaatccggcgaggtattccgcgctcaagcgtacaag
acaaaagtgctgaaaacctttggggccggtgactcctatgcgtcagcctttatctatggc
cttgtcagcggaaaagacattgaaacggcattgaaatacggcagtgcttcagcctccatt
gtggtgagcaagcacagttcgtcagaagcgatgccgactgcggaagaaatcgaacagctt
attgaagcacagtcataa

DBGET integrated database retrieval system