KEGG   Bacillus subtilis subsp. subtilis 168: BSU39750Help
Entry
BSU39750          CDS       T00010                                 

Gene name
iolB
Definition
(RefSeq) 5-deoxy-glucuronate isomerase
  KO
K03337  5-deoxy-glucuronate isomerase [EC:5.3.1.30]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00562  Inositol phosphate metabolism
bsu01100  Metabolic pathways
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    BSU39750 (iolB)
Enzymes [BR:bsu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.30  5-deoxy-glucuronate isomerase
     BSU39750 (iolB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: KduI
Motif
Other DBs
NCBI-GeneID: 937580
NCBI-ProteinID: NP_391854
Pasteur: BG11118
BSORF: BG11118
UniProt: P42413
Position
complement(4082030..4082845)
Genome map
AA seq 271 aa AA seqDB search
MSYLLRKPQSHEVSNGVKLVHEVTTSNSDLTYVEFKVLDLASGSSYTEELKKQEICIVAV
TGKITVTDHESTFENIGTRESVFERKPTDSVYISNDRAFEITAVSDARVALCYSPSEKQL
PTKLIKAEDNGIEHRGQFSNKRTVHNILPDSDPSANSLLVVEVYTDSGNWSSYPPHKHDQ
DNLPEESFLEETYYHELDPGQGFVFQRVYTDDRSIDETMTVGNENVVIVPAGYHPVGVPD
GYTSYYLNVMAGPTRKWKFYNDPAHEWILER
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgagttatttgttgcgtaagccgcagtcgcatgaagtgtctaatggggtcaaactcgtg
cacgaagtaacgacatccaactctgatctcacttatgtagagtttaaagtgttagatctt
gcatcaggttcaagctatacagaagaattgaaaaaacaagaaatctgtattgtggcggta
acggggaaaattacagtgacagatcatgagtcgacttttgagaatatcggcacgcgcgaa
agcgtatttgaacgaaaaccgacagacagcgtctatatttcaaatgaccgtgcatttgag
atcacagcggtcagcgacgcaagagtggcgctttgctattctccatcggaaaagcagctt
ccgacaaagctgatcaaagcggaagacaacggaattgagcatcgcgggcaattttcaaac
aaacgtactgttcataacattcttccggattcagacccttcagctaacagtctattagta
gttgaagtctatacagacagcggcaactggtccagctacccgcctcacaaacatgaccaa
gacaacttgccggaagaatctttcttagaagaaacgtactaccatgagttagacccggga
cagggctttgtgtttcagcgcgtatacacagatgaccgttctattgacgagacaatgact
gtgggaaatgaaaacgttgtcatcgttcctgcgggataccacccggtaggcgttccggac
ggatacacatcctactatttaaatgtcatggcagggccgacgcgaaaatggaagttttat
aacgacccggcgcatgaatggattttagaacgctaa

DBGET integrated database retrieval system