KEGG   Bacillus subtilis subsp. subtilis 168: BSU39760
Entry
BSU39760          CDS       T00010                                 

Symbol
mmsA
Name
(RefSeq) methylmalonate semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00280  Valine, leucine and isoleucine degradation
bsu00410  beta-Alanine metabolism
bsu00562  Inositol phosphate metabolism
bsu00640  Propanoate metabolism
bsu01100  Metabolic pathways
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    BSU39760 (mmsA)
   00562 Inositol phosphate metabolism
    BSU39760 (mmsA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BSU39760 (mmsA)
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    BSU39760 (mmsA)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     BSU39760 (mmsA)
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     BSU39760 (mmsA)
SSDB
Motif
Pfam: Aldedh
Other DBs
NCBI-GeneID: 937575
NCBI-ProteinID: NP_391855
Pasteur: BG11117
BSORF: BG11117
UniProt: P42412 A0A6M4JQU3
Structure
Position
complement(4082920..4084383)
AA seq 487 aa
MAEIRKLKNYINGEWVESKTDQYEDVVNPATKEVLCQVPISTKEDIDYAAQTAAEAFKTW
SKVAVPRRARILFNFQQLLSQHKEELAHLITIENGKNTKEALGEVGRGIENVEFAAGAPS
LMMGDSLASIATDVEAANYRYPIGVVGGIAPFNFPMMVPCWMFPMAIALGNTFILKPSER
TPLLTEKLVELFEKAGLPKGVFNVVYGAHDVVNGILEHPEIKAISFVGSKPVGEYVYKKG
SENLKRVQSLTGAKNHTIVLNDANLEDTVTNIVGAAFGSAGERCMACAVVTVEEGIADEF
MAKLQEKVADIKIGNGLDDGVFLGPVIREDNKKRTLSYIEKGLEEGARLVCDGRENVSDD
GYFVGPTIFDNVTTEMTIWKDEIFAPVLSVIRVKNLKEAIEIANKSEFANGACLFTSNSN
AIRYFRENIDAGMLGINLGVPAPMAFFPFSGWKSSFFGTLHANGKDSVDFYTRKKVVTAR
YPAPDFN
NT seq 1464 nt   +upstreamnt  +downstreamnt
atggcagaaatcagaaaattaaaaaactacatcaacggtgaatgggttgaaagcaaaaca
gatcaatatgaagatgtcgtcaatccggcgacgaaagaagtgctatgccaagtgccgatt
tctacaaaagaggatattgattacgcagcgcaaacagcggctgaagcatttaaaacatgg
tcaaaggtggcggttcctcgccgcgccagaattctatttaacttccagcagctgctgtct
cagcataaagaagaacttgctcatctaattaccattgaaaacggaaaaaacacgaaagaa
gctttaggtgaagtgggacgcgggattgaaaacgtagagttcgccgctggagcaccttcc
ctgatgatgggtgactcacttgcttccatcgcaacggacgttgaagcggcgaactaccgt
tacccaatcggagttgtcggcggaatcgcgccattcaacttcccgatgatggttccttgc
tggatgttcccgatggcgatcgcgctcggcaacacatttattttaaagccatctgagcgg
actccgctgttaacagagaaattggttgagctttttgaaaaagcgggccttccgaaaggg
gtgttcaacgtcgtatacggtgcgcatgacgttgtgaacggcatcctcgagcatcccgaa
attaaagcgatttcatttgtaggctccaagccagtaggcgaatacgtctacaaaaaagga
agcgaaaacttaaaacgcgttcaatctctgactggcgcgaaaaaccatacgattgtcttg
aacgatgcgaatcttgaagacacggttacaaacatcgttggagctgccttcggttctgcc
ggtgaacgctgcatggcttgtgcggttgtgacagttgaagaaggaatcgccgatgaattt
atggcgaagctgcaggaaaaagtggcggacattaaaatcggtaacggccttgatgacggc
gtgttcttaggaccggtgattcgcgaagacaacaagaagcgcacgctcagctatatcgaa
aaaggtcttgaagaaggtgccagactcgtatgtgacggacgtgaaaatgtgtctgacgac
ggctactttgtcggcccgacgatctttgacaatgtcacaacagaaatgacgatctggaaa
gatgaaattttcgctccggtcttatctgtcatccgtgtgaaaaacctgaaagaagcgatt
gaaatcgccaataagtctgagtttgcgaacggcgcctgcttgttcacatccaactcaaac
gcaatccgctacttccgtgaaaacattgatgcgggaatgctaggcatcaaccttggtgtg
ccggctccaatggcgttcttcccattctcaggctggaaatcttcattctttggaacgctg
catgcgaacggaaaagacagcgtcgacttctatacacgtaaaaaagtggtgacggcaaga
tatccggcacctgatttcaactaa

DBGET integrated database retrieval system