KEGG   Bacillus subtilis subsp. subtilis 168: BSU39770
Entry
BSU39770          CDS       T00010                                 

Symbol
iolR
Name
(RefSeq) HTH-type transcriptional regulator IolR
  KO
K06608  DeoR family transcriptional regulator, myo-inositol catabolism operon repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU39770 (iolR)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   DeoR family
    BSU39770 (iolR)
SSDB
Motif
Pfam: DeoRC HTH_DeoR HTH_11 FeoC HTH_PafC HTH_36 HTH_20 GntR HTH_24 Mga TrmB MarR_2 HTH_41 SpoIIID HTH_Mga Fe_dep_repress DDRGK HTH_psq TFIIE_alpha Polysacc_deac_2 MarR HTH_Crp_2 PuR_N
Other DBs
NCBI-GeneID: 937635
NCBI-ProteinID: NP_391856
Pasteur: BG11364
BSORF: BG11364
UniProt: P46337 A0A6M4JQX4
Position
4084799..4085554
AA seq 251 aa
MKLMRIQEMEEYILSHGTVSLDELCQVFNVSKNTVRRDINKLTEKGAIEKVYGGVTSIEK
TALVPFENRTIQHQDEKTKIAHYASRFIEDHDLVFIDSGTTTKSILDTLDPAKNVTILTN
SLDIINAASALKNINLIIIGNNYKRKTRSFVGMDDPAMLDKYNINKAFMSATGTTLTHGL
TNSDLLEYEIKKRISEKAKEVYLLADHSKFGKSTLLTYAPFDRLHCIVTSQPLDDEYTQY
CNEHQIGIHLA
NT seq 756 nt   +upstreamnt  +downstreamnt
atgaaactgatgcggattcaggaaatggaggagtacattttatcgcatggcactgtttcc
ttagatgagctgtgccaggtgttcaatgtctccaaaaacacagtcagacgtgatatcaac
aagctaacagaaaagggtgcgattgaaaaagtatacggcggcgtaacatctattgaaaaa
accgcattagttccttttgaaaatcgcaccattcagcaccaggatgaaaaaacaaaaatc
gcccattatgcttcccgatttattgaagatcacgatttggtcttcattgattcaggaacg
acgacaaagtctattcttgatacgcttgatccagccaaaaatgtcaccatcttaaccaac
agtttagacattatcaatgcggcgtcagctttgaagaatatcaacttaatcattatcgga
aacaactataagagaaaaacccgctcctttgtcggcatggacgacccggctatgcttgat
aagtacaatatcaacaaagcctttatgtccgctaccggaacgacgctgactcacggattg
accaattcggatctgctggagtatgaaattaaaaagaggatttcagaaaaagcaaaagaa
gtgtatctattggctgaccattctaaattcggaaaatcaacgcttctgacgtatgcaccg
tttgacaggctgcattgcattgtgacctctcagccattagacgacgagtacacgcagtac
tgcaatgagcatcaaatcggcattcatctggcctaa

DBGET integrated database retrieval system