KEGG   Bacillus subtilis subsp. subtilis 168: BSU39780
Entry
BSU39780          CDS       T00010                                 

Symbol
iolS
Name
(RefSeq) aldo/keto reductase family protein IolS
  KO
K06607  myo-inositol catabolism protein IolS [EC:1.1.1.-]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU39780 (iolS)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.-  
     BSU39780 (iolS)
SSDB
Motif
Pfam: Aldo_ket_red
Other DBs
NCBI-GeneID: 937636
NCBI-ProteinID: NP_391857
Pasteur: BG11363
BSORF: BG11363
UniProt: P46336 A0A6M4JQX2
Structure
PDB: 
1PYF 1PZ0

Position
4085608..4086540
AA seq 310 aa
MKKAKLGKSDLQVFPIGLGTNAVGGHNLYPNLNEETGKELVREAIRNGVTMLDTAYIYGI
GRSEELIGEVLREFNREDVVIATKAAHRKQGNDFVFDNSPDFLKKSVDESLKRLNTDYID
LFYIHFPDEHTPKDEAVNALNEMKKAGKIRSIGVSNFSLEQLKEANKDGLVDVLQGEYNL
LNREAEKTFFPYTKEHNISFIPYFPLVSGLLAGKYTEDTTFPEGDLRNEQEHFKGERFKE
NIRKVNKLAPIAEKHNVDIPHIVLAWYLARPEIDILIPGAKRADQLIDNIKTADVTLSQE
DISFIDKLFA
NT seq 933 nt   +upstreamnt  +downstreamnt
atgaaaaaagcgaagctcggaaaatcagacttgcaggtattccctatcggattaggaaca
aatgctgtcggaggacataacctctacccgaacctaaatgaagaaaccggaaaagaattg
gtgcgcgaggcgatccgtaatggcgtgacaatgttagacaccgcttacatttacgggatc
ggccgttccgaagaattaattggtgaagtgctgcgtgaattcaaccgtgaagatgttgtc
atcgcgacaaaagccgctcacagaaaacaaggcaatgactttgtctttgataattcacca
gattttcttaaaaaatcagttgatgaaagcctgaagcgcttgaataccgattatattgat
ttgttctacattcacttccctgacgaacatacgcctaaggatgaagccgttaacgcgctg
aatgagatgaagaaagccggaaaaatccgttccatcggtgtatccaacttctctttagag
caattgaaagaagcaaacaaagacggtttggtagatgtattgcaaggcgaatacaacctg
ttaaaccgtgaagcggaaaaaacattcttcccgtatacgaaggagcataatatttcattt
atcccttacttccctctcgtatcaggtttattggcaggaaagtatacagaagatacaacg
ttcccagaaggcgacctgcgaaacgaacaggaacacttcaagggtgagcgtttcaaagaa
aatatcagaaaggtcaacaagcttgcgccgattgccgaaaaacacaacgtggatatccct
cacatcgtattggcctggtatttagcaagaccggaaattgatattttaatcccaggagca
aaacgtgccgatcagctgattgataacatcaaaacagctgacgtgacgctttctcaagag
gatatttcatttattgataagctgttcgcataa

DBGET integrated database retrieval system