KEGG   Bacillus subtilis subsp. subtilis 168: BSU39790
Entry
BSU39790          CDS       T00010                                 

Symbol
yxcE
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sec62
Other DBs
NCBI-GeneID: 937621
NCBI-ProteinID: NP_391858
Pasteur: BG11362
BSORF: BG11362
UniProt: P46335 A0A6M3ZHU9
Position
4086802..4087452
AA seq 216 aa
MKLKYVKALVAVTVALGVLLPSTISHAKSFSGRSSSSYSSRSSSSSYSGSYKSSPKSSYS
SGSSSSSKKSKTSDDSSSSISLKKKPSEKASSSSSKKSSGTFSGATSKVTGKTYSGKTSK
AYVGGRYVSVNHYYHAGFAPSGWFGYYSGFTMGMFMISMMHPWGYTYHPVGGPGYVSYGA
SPIAWIVDIIALIIILIIVIALIRAFKAPKTYRRRF
NT seq 651 nt   +upstreamnt  +downstreamnt
atgaaacttaaatatgtaaaagccttagttgcagtaaccgttgctttaggtgtactgctg
ccatcaacgatttctcatgcaaagagctttagcggccgctcatcatctagttacagcagc
cgaagttcaagctcatcatacagcggaagctataaatcaagcccgaaatcaagctacagc
tcaggatcaagctcttctagcaaaaaatccaagacgtctgacgattcatcatcatcgatt
tcgcttaaaaagaagccttcggaaaaggcaagttcatcaagctctaaaaaatcgtcaggc
accttttccggcgctacatcaaaagtaaccggaaagacatacagcggaaaaacgtctaaa
gcctatgttggcggacgttatgtttcagtcaatcattactatcacgcaggtttcgcgcca
tcaggatggtttggatattatagcggatttacaatgggtatgttcatgatcagcatgatg
cacccatggggttacacctatcatccagtcggaggccccggttatgtttcttatggcgct
tcacccattgcctggatcgttgatatcatcgctttgattattattttaatcattgtcatc
gcattgattcgcgcatttaaagcaccgaagacgtacagaaggagattttag

DBGET integrated database retrieval system