KEGG   Bacillus subtilis subsp. subtilis 168: BSU39800
Entry
BSU39800          CDS       T00010                                 

Symbol
yxcD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2653
Other DBs
NCBI-GeneID: 937638
NCBI-ProteinID: NP_391859
Pasteur: BG11361
BSORF: BG11361
UniProt: P46334 A0A6M4JQU6
Position
4087456..4087764
AA seq 102 aa
MRLILNEQEIVDGICVYISNEEDIYPEDVEVKELSYNKRTGFFAEATFGLHHKQLMSDDI
SEGIIQFLEEYHNFNPDVTVVELQFDKKKGFSALVFVNEAEE
NT seq 309 nt   +upstreamnt  +downstreamnt
atgagattaatattaaatgagcaagaaattgtagacggaatttgcgtgtatatttccaat
gaagaagatatctaccctgaagacgttgaagtaaaagaactatcgtacaacaagcgtaca
gggttcttcgctgaagctacatttggcctgcaccacaagcagcttatgtcagatgacatt
tcagaaggcattattcagttcttagaggaataccacaacttcaatccggacgttaccgtc
gttgaattgcaatttgataagaaaaaaggcttctccgccttggtttttgtcaacgaagca
gaagaataa

DBGET integrated database retrieval system