KEGG   Bacillus subtilis subsp. subtilis 168: BSU39810
Entry
BSU39810          CDS       T00010                                 

Symbol
csbC
Name
(RefSeq) metabolite transport protein CsbC
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12 MAP17
Other DBs
NCBI-GeneID: 937639
NCBI-ProteinID: NP_391860
Pasteur: BG11360
BSORF: BG11360
UniProt: P46333 A0A6M3ZI04
Position
4088002..4089387
AA seq 461 aa
MKKDTRKYMIYFFGALGGLLYGYDTGVISGALLFINNDIPLTTLTEGLVVSMLLLGAIFG
SALSGTCSDRWGRRKVVFVLSIIFIIGALACAFSQTIGMLIASRVILGLAVGGSTALVPV
YLSEMAPTKIRGTLGTMNNLMIVTGILLAYIVNYLFTPFEAWRWMVGLAAVPAVLLLIGI
AFMPESPRWLVKRGSEEEARRIMNITHDPKDIEMELAEMKQGEAEKKETTLGVLKAKWIR
PMLLIGVGLAIFQQAVGINTVIYYAPTIFTKAGLGTSASALGTMGIGILNVIMCITAMIL
IDRVGRKKLLIWGSVGITLSLAALSGVLLTLGLSASTAWMTVVFLGVYIVFYQATWGPVV
WVLMPELFPSKARGAATGFTTLVLSAANLIVSLVFPLMLSAMGIAWVFMVFSVICLLSFF
FAFYMVPETKGKSLEEIEASLKKRFKKKKSTQNQVLNERTL
NT seq 1386 nt   +upstreamnt  +downstreamnt
gtgaagaaagacacaaggaaatatatgatctactttttcggcgctttagggggactgcta
tatggttacgatacaggtgttatctccggagcactcctgtttatcaataacgatattcct
ttaacgacattgacagaaggattggttgtcagcatgctgctccttggcgcgattttcggt
tctgccttgagcggcacatgctcagaccgctggggcaggagaaaggttgtatttgtcctt
tccatcatttttattatcggtgcgctcgcttgcgcattttctcaaacaatcggcatgctg
attgcatctagggtgatactcgggttggccgtcggcggttcaacggcacttgtgcccgtg
tatctttccgaaatggcaccgacgaaaattcgcgggacactcggcacaatgaacaactta
atgattgtcaccgggattttgctcgcctatatcgttaactacctgttcacaccgtttgaa
gcgtggcgctggatggtcggtctggctgcagtgcctgccgtgcttctattaatcggcatc
gccttcatgccggaatcgccaagatggctcgtgaagcgcggcagcgaagaagaagcgaga
cgcatcatgaacatcactcatgaccccaaagacatcgaaatggaattggcagagatgaag
caaggggaagcggagaaaaaagaaacgacacttggcgtgctgaaagccaagtggattcgc
cctatgcttctgattggcgtcggccttgccattttccagcaggcagtcggcattaacacg
gtcatctactacgcgccaaccatttttacgaaggccggtcttggcacatcagcttcggcg
ctcggcacaatgggaatcggcatcctcaacgtcatcatgtgtatcactgccatgatctta
attgaccgtgtcggccgcaaaaaacttctgatctggggaagtgtcggcatcacactgagc
cttgctgctttatcaggcgtgctcctgacactggggctttccgcatcaacagcgtggatg
acagtagtctttctcggtgtctatatcgtcttttaccaggcgacatggggtccggtagtg
tgggtgctcatgcctgagctcttcccgtccaaagcacgcggagccgcgacagggttcacg
actttggtgttatcggcggctaacctgatcgtgtcgcttgtcttcccgctgatgctaagc
gcgatgggcatcgcatgggtctttatggttttctcagtcatttgtcttctctcatttttc
ttcgcgttctacatggtaccggaaaccaaagggaaaagcttggaggaaattgaagcaagc
ctgaaaaaacggtttaaaaagaagaaaagcacccaaaaccaagtgctgaatgagcgtaca
ttataa

DBGET integrated database retrieval system