KEGG   Bacillus subtilis subsp. subtilis 168: BSU39820
Entry
BSU39820          CDS       T00010                                 

Symbol
htpG
Name
(RefSeq) chaperone protein HtpG
  KO
K04079  molecular chaperone HtpG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:bsu01009]
    BSU39820 (htpG)
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:bsu03110]
    BSU39820 (htpG)
   04131 Membrane trafficking [BR:bsu04131]
    BSU39820 (htpG)
   03051 Proteasome [BR:bsu03051]
    BSU39820 (htpG)
   03029 Mitochondrial biogenesis [BR:bsu03029]
    BSU39820 (htpG)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:bsu04147]
    BSU39820 (htpG)
Protein phosphatases and associated proteins [BR:bsu01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     BSU39820 (htpG)
Chaperones and folding catalysts [BR:bsu03110]
 Heat shock proteins
  HSP90
   BSU39820 (htpG)
Membrane trafficking [BR:bsu04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    BSU39820 (htpG)
Proteasome [BR:bsu03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    BSU39820 (htpG)
Mitochondrial biogenesis [BR:bsu03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    BSU39820 (htpG)
Exosome [BR:bsu04147]
 Exosomal proteins
  Proteins found in most exosomes
   BSU39820 (htpG)
SSDB
Motif
Pfam: HSP90 HATPase_c_3 HATPase_c HBS1_N DUF6022 DUF5024
Other DBs
NCBI-GeneID: 937631
NCBI-ProteinID: NP_391861
Pasteur: BG11359
BSORF: BG11359
UniProt: P46208 A0A6M3ZKH0
Position
complement(4089429..4091309)
AA seq 626 aa
MAKKEFKAESKRLLDMMINSIYTQKEIFLRELISNSSDAIDKIYYKALTDDALTFDKDSY
YIKVAADKDARTLTISDTGIGMTKDELEQHLGTIAKSGSLAFKKENELKDGHDIIGQFGV
GFYAAFMVADVVTVISKALGSEEAYKWESAGADGYTIEPCEKDSVGTDIILKIKENTEDD
SYDEFLEEYRLKAIIKKYSDFIRYPIKMDTTINKPKEGSENEFEEVQEEQTVNSMVPIWR
KNKSELTDEDYEKFYAEKHYGFDKPLTHVHISVDGAVRYNAILFVPENMPFDYYSKEYEK
GLELYSNGVLIMNKCADLLPDHFSFVKGMVDSEDLSLNISREMLQHDRQLKLIAKNISKK
IKSELQSLLKKDREKYETFYKSFGRQLKFGVYNDFGANKDQLKDLLLFYSSKEKKLVSLD
EYVSRMPEEQKFIYYATGDSYDRIEKLPQTEMVADKGYEILYFTEDIDEFAIKMLASYQE
KEFKSVSSGDLGIDTDEDQKQSEEEESKYKDLFEEMKNILSDKVKNVRISKRLKSHPVCL
AADGEVTIEMEKILNAMPDSQNVKAEKVLEINPNHEVFQTLQDAFEQDKEKLSLYTNLLY
NQALLIEGLPIQDPVEFTNNICKVMV
NT seq 1881 nt   +upstreamnt  +downstreamnt
gtggcgaaaaaagagtttaaagcagagtctaaacgcttgctggatatgatgattaactcc
atttatacccaaaaagaaattttcctgcgcgagttaatctccaattcgagtgatgcgatt
gacaaaatctattacaaagcgcttacggacgatgcgcttacgtttgataaagacagttac
tacataaaggtcgcagctgacaaagatgcgagaacattaaccatctctgatacggggatc
ggaatgacaaaggatgagcttgaacagcatcttggaacaattgcaaaaagcggttccctc
gcgtttaaaaaggaaaacgagctgaaagacggacatgacattatcgggcagttcggtgtc
ggtttttacgcggcatttatggttgccgatgtcgtgacagtcatcagtaaagcgcttggc
agcgaagaggcttataaatgggagtctgcgggtgcagacggctatacgattgagccgtgt
gaaaaggattctgtcggtacagacattatcctgaaaatcaaagagaacacagaagatgac
agctatgacgagtttttagaggaatatcgtttaaaagcgatcatcaagaagtactccgac
ttcattcgctacccgatcaaaatggatacaaccattaataagccgaaggaaggcagcgaa
aatgaatttgaagaggtgcaggaagagcagacggtcaacagcatggtgccgatctggaga
aaaaacaaaagcgagctgacagatgaggattatgaaaaattctatgctgaaaagcattac
gggtttgataaaccgctgacacacgttcatatcagcgtggatggagcggttcgctacaac
gcgattctattcgtccctgaaaacatgccgtttgactactattccaaggaatatgagaaa
ggcttggagctgtattccaatggcgtgctgatcatgaataagtgcgcagacctgctaccg
gaccacttcagctttgtgaagggcatggtcgattctgaggatctgtcgctgaatatttcc
agagaaatgctgcagcatgaccgccagctgaagctgatcgcgaaaaacatcagcaagaaa
atcaaaagcgagctgcaaagcctgttgaaaaaagaccgcgagaaatacgagacgttctac
aagtcgttcggcagacagctgaaattcggcgtgtacaatgattttggcgcgaataaggat
caattgaaggatctcctcttattctactcttcaaaagagaaaaaactggtcagcttagac
gagtatgtttccagaatgccagaggagcagaaattcatttattacgcgaccggtgattct
tacgaccgcattgagaaactgccgcaaacggaaatggtggcggacaaaggctatgaaatc
ctctactttactgaggacatcgatgagtttgcaattaaaatgctggcttcttatcaggaa
aaagaattcaagtccgtatcaagcggagaccttggcatagacacggatgaggatcaaaag
cagtccgaggaagaggaaagcaagtataaggatctgtttgaggaaatgaaaaacattctg
tcagacaaagtgaaaaacgtcagaatctcaaaacggcttaaatcacatccagtctgcctt
gctgctgacggcgaagtgacaattgagatggaaaaaatcttaaatgcgatgcctgacagc
caaaatgtgaaggcggaaaaagtgctggaaatcaacccaaatcacgaggtattccaaaca
ctgcaggacgcgtttgaacaagataaagagaagctgagcctgtacacaaaccttctgtac
aatcaggcgctcctcatcgaaggcctgccgattcaggaccctgtggaatttacgaacaat
atttgcaaggtcatggtgtaa

DBGET integrated database retrieval system