KEGG   Bacillus subtilis subsp. subtilis 168: BSU39840
Entry
BSU39840          CDS       T00010                                 

Symbol
yxbG
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short_C2 adh_short KR 3HCDH_N Epimerase 2-Hacid_dh_C
Other DBs
NCBI-GeneID: 937642
NCBI-ProteinID: NP_391863
Pasteur: BG11357
BSORF: BG11357
UniProt: P46331 A0A6M4JQW8
Position
4091845..4092666
AA seq 273 aa
MGRLENKTAVITGAATGIGQATAEVFANEGARVIIGDINKDQMEETVDAIRKNGGQAESF
HLDVSDENSVKAFADQIKDACGTIDILFNNAGVDQEGGKVHEYPVDLFDRIIAVDLRGTF
LCSKYLIPLMLENGGSIINTSSMSGRAADLDRSGYNAAKGGITNLTKAMAIDYARNGIRV
NSISPGTIETPLIDKLAGTKEQEMGEQFREANKWITPLGRLGQPKEMATVALFLASDDSS
YVTGEDITADGGIMAYTWPGKMLIEEKWKEETK
NT seq 822 nt   +upstreamnt  +downstreamnt
atgggaagacttgaaaacaaaacagcagttatcacaggcgccgcgacaggcattggtcaa
gcgacggcggaggtttttgccaatgaaggcgcgcgtgtgatcatcggagatatcaataaa
gatcaaatggaagaaacagttgacgcaatcagaaaaaacggaggacaggccgaatccttt
cacctcgatgtgtcagatgaaaacagtgtgaaagcatttgctgatcaaatcaaggatgca
tgcggaacgattgatattctgtttaataatgccggcgttgatcaggaaggcggaaaggtg
cacgaatatccggttgacctgtttgaccgcattatcgccgtcgacctgcgcggcacattc
ctttgcagcaaatatttgattccgctcatgctcgaaaatggaggctccatcatcaacacc
tcctccatgtcaggccgtgccgcggaccttgaccgctccggctacaacgccgcaaaaggc
ggtatcaccaacctgacaaaggcaatggcaatcgactacgcacgaaacggcatccgcgtc
aattccatttcaccgggcacgatcgaaacaccgctgattgacaaattagcaggcacaaaa
gaacaggaaatgggcgaacaattccgcgaagccaacaaatggatcacgccgctcggacgt
cttggccagcccaaagaaatggcaacagtggcactgttcctcgcatcagacgacagctca
tacgtcacaggagaagacatcaccgcagacggcggcatcatggcgtacacatggcctggg
aagatgctgattgaggagaaatggaaggaagaaacgaaataa

DBGET integrated database retrieval system