KEGG   Bacillus subtilis subsp. subtilis 168: BSU39850
Entry
BSU39850          CDS       T00010                                 

Symbol
yxbF
Name
(RefSeq) HTH-type transcriptional regulator YxbF
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: TetR_N TetR_C_8 HTH_Tnp_1_2 HTH_11 DEK_C Sigma70_r4
Other DBs
NCBI-GeneID: 937637
NCBI-ProteinID: NP_391864
Pasteur: BG11356
BSORF: BG11356
UniProt: P46330 A0A6M4JR12
Position
complement(4092695..4093837)
AA seq 380 aa
MPESAEAQVKEALLALLKDRDIQHITMKEIAEKAKVSRGSLYLYYEDKFSIIEDVIEDMK
EGLGKALFDAFSHMDTLHLNKKRQTVHPTLSFVHEHRSFFSVMMNRGHFHRFFKDVFQQD
VLLAPIHVNLTPIERDIYGHYRALYTYAIILYWLNEDAAASPEAISQKVWELVSQKRFYW
LFGKAVPGEREKEKQIDRRVVRTREALQKAFLDVLAEKQDYAGITISDITRKSNIRRATF
YDHYANKEELLQTMIQRSCAEIIDHLTIASSPNEFSLKEAEKALAILLSALSNMPIVHFL
NREWGVPHVIPDMFKALESFYLHQQTDIHAEKKLYAHYVSAMIIGLLLYRLDEGKAHPPE
VLAREFLQFLDVKKYKVVLL
NT seq 1143 nt   +upstreamnt  +downstreamnt
gtgccggaatctgccgaagctcaagtgaaagaggcgctgctggctttattgaaagataga
gatattcaacacatcacaatgaaagaaatcgctgagaaggccaaagtgagccgcggatcg
ctctacctttattatgaggataagttttcaatcattgaggatgtgatcgaagacatgaag
gaaggactgggcaaagcgctttttgacgccttcagtcatatggatacccttcatttgaac
aaaaaacggcaaacggtgcatccgacgctgtcctttgttcatgagcatcgttcctttttt
tctgtgatgatgaacagaggacattttcatcgtttttttaaggatgtgtttcagcaggat
gtgctgctggctccgatccatgtgaatttaacgccgattgaacgggacatttatggacat
tatcgggccttgtacacgtacgcgattatcctgtattggctgaatgaggatgcggccgcg
tctcctgaagccatcagccagaaggtatgggagcttgtttctcaaaagcggttttattgg
ctgtttggaaaagctgtgccaggagagcgagagaaggagaagcaaatcgacaggcgggtg
gttcgaacgagagaggcgctgcagaaggcatttctggatgtattggcggagaaacaagac
tacgcgggcatcacgatttcagatattacgcgtaaaagcaatatccgccgtgcaaccttt
tatgatcactatgccaataaggaggaattgctccaaaccatgatacagcgatcatgtgcg
gagatcattgatcacctgacgattgcctccagcccgaatgaattttccttaaaggaagcg
gagaaggcgctcgccattctgctttctgctttgtcaaacatgcccattgtccattttctc
aatcgggaatggggtgttcctcatgtgatacctgatatgttcaaagcgctggaatcgttt
tatctgcatcagcaaactgatattcacgcagagaaaaagctttatgcccattatgtatcc
gcaatgattatcgggttgcttttgtatcggctggatgaaggaaaggcgcatccgcctgaa
gtgctggcgagggagtttttgcagtttttggatgtgaagaaatataaggttgtattgctt
taa

DBGET integrated database retrieval system