KEGG   Bacillus subtilis subsp. subtilis 168: BSU39870
Entry
BSU39870          CDS       T00010                                 

Symbol
yxbD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Acetyltransf_1 Acetyltransf_10 Acetyltransf_7 Acetyltransf_4 FR47 Phos_pyr_kin
Other DBs
NCBI-GeneID: 937655
NCBI-ProteinID: NP_391866
Pasteur: BG11354
BSORF: BG11354
UniProt: P46328 A0A6M3ZI46
Position
complement(4095356..4095835)
AA seq 159 aa
MNIIPTCQVPKDLVSAFFQKHWGSPQMVISSGIYNCDELDGYGMLNDDNQIVGLITYIFE
EDACEIISLDSVIENKGIGTALLEKAEEACRERNIKQIKLITTNDNIHALAFYQKRGYRL
DRLFVNAVETARKMKPEIPLLADNKIPIRDELLLVKELQ
NT seq 480 nt   +upstreamnt  +downstreamnt
atgaatattattccgacatgccaggtacctaaagatcttgtttccgcgttttttcaaaaa
cactggggcagtccgcaaatggttatttctagcggtatttataactgcgatgaattagat
ggttatggaatgctcaacgatgataaccagattgttggccttattacatacatatttgaa
gaagatgcctgtgaaatcatttcgctggatagtgtcattgagaataaagggatcggaaca
gctctgctagagaaagccgaggaagcatgcagagagagaaatatcaaacaaataaaactg
atcacaaccaatgataatattcatgcattagcgttttatcagaagagagggtaccggttg
gatcgactatttgtgaatgcagtcgagacggccagaaagatgaagcccgaaattccttta
ctggcagataataaaatacctatccgtgatgaattgcttttggtcaaggagttacaataa

DBGET integrated database retrieval system