KEGG   Bacillus subtilis subsp. subtilis 168: BSU39900
Entry
BSU39900          CDS       T00010                                 

Symbol
aslA
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PqqD DUF6707
Other DBs
NCBI-GeneID: 937675
NCBI-ProteinID: NP_391869
Pasteur: BG11351
BSORF: BG11351
UniProt: P46325 A0A6M3ZHV7
Position
4098150..4098419
AA seq 89 aa
MINESTVLSKNPEMPSRKYLKSIIIEPGITLNEMASDIYNHIDGKVSIHDICSKIVNEYD
VDYQTCLEDCMELFELLIDHEAIKVKQGA
NT seq 270 nt   +upstreamnt  +downstreamnt
atgatcaatgaatcaactgttttatccaaaaatccagaaatgccatcaagaaaatatttg
aaaagcattattatagagccgggcatcactttaaatgaaatggcatcagatatttataac
catatcgacggcaaggtcagcatacatgatatttgctcaaaaatcgtcaatgaatatgat
gttgattatcaaacctgcttagaagattgtatggagctgtttgagttgcttattgatcat
gaagcaatcaaagttaagcagggggcatga

DBGET integrated database retrieval system