KEGG   Bacillus subtilis subsp. subtilis 168: BSU39910
Entry
BSU39910          CDS       T00010                                 

Symbol
yxnB
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Stap_Strp_tox_C
Other DBs
NCBI-GeneID: 937643
NCBI-ProteinID: NP_391870
Pasteur: BG14166
BSORF: BG14166
UniProt: O34704 A0A6M3ZI12
Position
4098423..4098905
AA seq 160 aa
MEKQKVLALPDDVHELSTHRSKSIVNYIITLLAFAKKQGLTHQDIVSWIHEQYEERGYYD
EWRHINSQQPVGSFVELFIKGRRLLYDKIELFETEDKYVVNTHTWYEKEPSEAFFYFEID
PEEFSAYASILAIENAKRLGIKIDIVKETDVETAYIYKHQ
NT seq 483 nt   +upstreamnt  +downstreamnt
ttggaaaaacaaaaagtgcttgctttaccagacgatgtacatgagctgagtacacaccgt
tctaaatcaatcgtaaattacatcatcactctgcttgcctttgccaaaaaacaaggattg
actcatcaagatattgtaagctggattcacgagcaatatgaggaaagaggatattatgat
gagtggagacacattaacagccaacaaccagttggatcatttgtggaactctttataaaa
ggaagacgtttactttatgacaaaattgaattgtttgaaacagaagataaatatgtcgta
aatacccacacttggtatgaaaaagaacctagtgaggcctttttttattttgaaattgat
cccgaagaattttctgcgtacgcttccattctcgcaatcgaaaacgcaaaacgtctcgga
attaaaatcgatattgtaaaagaaacagatgtagagacagcttatatctataaacatcaa
taa

DBGET integrated database retrieval system