KEGG   Bacillus subtilis subsp. subtilis 168: BSU39920
Entry
BSU39920          CDS       T00010                                 

Symbol
asnH
Name
(RefSeq) asparagine synthetase 2
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00250  Alanine, aspartate and glutamate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    BSU39920 (asnH)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU39920 (asnH)
Enzymes [BR:bsu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     BSU39920 (asnH)
Peptidases and inhibitors [BR:bsu01002]
 Cysteine peptidases
  Family C44
   BSU39920 (asnH)
SSDB
Motif
Pfam: Asn_synthase GATase_7 GATase_6 NAD_synthase
Other DBs
NCBI-GeneID: 937677
NCBI-ProteinID: NP_391871
Pasteur: BG11116
BSORF: BG11116
UniProt: P42113 A0A6M3ZI13
Position
4098926..4101169
AA seq 747 aa
MCGLAGIINLAAPRSQECTFHILKGMADAISYRGPDDEQYHIDSKVGFAFRRLSILDLVN
GQQPFLNEDGSIVVMVNGEIYNYKELKASLHNHMFKTTSDCEVIVHLYEEKGIGFVDDII
GMFSIAIWDKNKNKVFLVRDRFGIKPLFYTELKHELIFASEIKSLFSHPHCPRQFNWKEA
LSDIWLSGEAASNHKETTSFFVNIQNLDAGHYLEINLTTNERKTASYWSLQDILLRQGYR
ENLHPDDLIEGYRELLADSVHRCLQSDVEVGLFLSGGIDSAAVAHFAAEKQDLHTFTVLS
QSTFTNEDAKYAHWLAKDLHLPNHQVLYQLGNDELLQPESYKHLLWICETPFCGPEQLYK
FHLHKYAKAIRPNLKVMLTGQGSDEFNGGYSTTLSPAENPSWEGFIESVNTMEMNRLHRL
QGNIFRVWEEHFGLSPINLSYLKSNDSSQADPWQSYVLTKYRDLQMYNCWHEDRIAAANH
IENRVPFLDHRLVEWVCGIPDGLRKDLLWDKSVLRKSLTNELHTSYTHRPKVPFFYGKDV
RYTHKMMFHLLKKNNYQLIEEAFSHSDASSIIQVEHIHAIMTYLEDDPEFTNFEFLLRLV
NMGLLSKMTKETPSVQLDITSHLESITIKDWHSQEGDIASRLNISANKCEGQDILALNPG
VTLLRPESDSEHCIYIAEEGFIQFIVSEEDVGAWLHILCDINGKDTLHTILDRHGVSLEE
VAKYIQEAIEHNIILIKQKNLPEGAYR
NT seq 2244 nt   +upstreamnt  +downstreamnt
atgtgcgggctcgcgggtattataaatctggctgctccccgttctcaggaatgtaccttt
catatattgaaaggcatggcagatgccatcagctataggggaccggatgatgaacaatat
catattgattccaaagtcggctttgcatttcggcgattgtccattcttgaccttgtaaat
ggacagcagccctttttaaatgaggatggatcaatcgtcgttatggtaaatggagaaatt
tataactataaagaactgaaggcttctttacacaatcatatgtttaaaacgacatctgat
tgtgaagtaattgttcatttatatgaagaaaaagggattggatttgtagacgacatcatc
ggaatgttttcaatagccatttgggacaaaaataaaaacaaagtatttttagttcgtgac
cgctttgggattaaaccgcttttttacacagagctaaaacacgagcttatatttgcctct
gaaataaaatccctattttctcatcctcactgtccccgccaatttaattggaaagaagca
ctctcagacatttggctaagcggggaagcagccagtaatcataaagaaaccacttccttt
tttgtaaacatccaaaatctcgatgctggccattatctcgaaattaatttgacaacaaat
gaacgaaaaacagcaagctattggtctttacaggatattttgctcaggcaaggctatcgt
gagaatctccatcccgatgacctgattgaaggatatagagaactgctggcagattcagtc
catagatgtttacaaagcgacgttgaagtcgggttgtttcttagcggtggcattgattca
gctgcagtcgcacattttgctgcagaaaaacaggatctccatacgtttacagtattaagc
caaagtacatttacaaatgaagatgcaaaatatgcccattggctggctaaagatttacac
cttccaaatcatcaggttctctatcaattagggaacgatgagttattacaaccagagtca
tataaacatttgttatggatctgtgaaacaccgttttgcggaccggaacaattatataag
tttcatttacataagtatgccaaagcgataaggccaaacctgaaagtcatgctgaccggc
cagggcagcgacgaatttaacggcggttacagcacgacactttcaccagccgagaaccca
agttgggaaggatttattgaatcggtcaatacgatggagatgaaccggctgcatcggctg
cagggaaatatctttagagtgtgggaggagcattttggactttctcctataaacctttct
tatttaaagagcaatgattccagccaagcagatccttggcaatcgtatgtcctgacaaaa
taccgtgatctgcaaatgtataattgctggcatgaagatcggatcgccgcggctaatcat
atcgaaaaccgtgtaccgttcttggaccatcggcttgttgaatgggtttgcggaatacct
gatggactccgtaaagacttgttatgggataagtcggtattgcgaaaatcattaacaaat
gagctgcatacaagctatacccaccggccaaaggttccttttttctatggtaaggacgtg
agatatacacataaaatgatgtttcatcttctgaagaaaaacaattatcagcttatagag
gaggccttctctcacagcgatgcctccagcataatacaggttgaacacattcatgccatc
atgacatatttggaggatgatcctgagtttacaaattttgaatttttattaagactggtg
aacatgggacttttatcaaaaatgactaaagaaaccccttctgttcaattagacataacc
agccatttagaatcgataacaataaaagactggcactcacaggaaggtgatattgccagt
cgtttaaatatctcagccaataagtgtgaaggacaagatattttggcgctaaaccctggc
gtcactctgttaaggccggaaagcgatagtgagcattgcatctacattgcggaagaagga
tttattcagtttattgtttcggaggaagacgtcggagcttggctgcatattctctgcgat
attaatggaaaagacacacttcatacgattttagacagacatggtgtcagccttgaagaa
gtggccaaatatattcaagaagccatcgaacacaatatcattttgatcaaacaaaaaaat
ctgccagaaggagcatatagatga

DBGET integrated database retrieval system