KEGG   Bacillus subtilis subsp. subtilis 168: BSU39930Help
Entry
BSU39930          CDS       T00010                                 

Gene name
yxaM
Definition
(RefSeq) MFS transporter
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MFS_1 MFS_1_like
Motif
Other DBs
NCBI-GeneID: 937678
NCBI-ProteinID: NP_391872
Pasteur: BG11115
BSORF: BG11115
UniProt: P42112
Position
4101166..4102365
Genome map
AA seq 399 aa AA seqDB search
MSIFYSFSALRGLAMGIFSPIWILYLISKDYDFLQIGLMGAVLEIAKLIFEVPSGVFADR
YGIKISIASSFFFSILTWAFFPFIDSAAICILAMIIWALSDSLISGSFETWMSRVAGEDR
FGKEMMKNTQLLITFLIIGSIASGYLYSLNIYFPFLLVMVIYLLLFIWMSVFIKVPSVSE
TNHGDQNQHDSIKIIKESLKIIFNKKRVLLIVIAGFFTATAYDTISRYWQPFLSDLGFSE
KSLGYIFALGGFTALVLLTLTIRFEKKIEKNPYLALTSLDSMGMVMTFLLSRAFRPLGIP
CTAFLLAIEDIHHPIVTSYLNKFFPDSYKNTLFSLNSGVGAIGEILSGVIFGIISAAFGL
SAMFVVVAVFLLIPIILYTIVPKIKDNDMKVQIEKSQQV
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgagcatcttttattcgttttccgcacttaggggattagcaatggggattttttcgcct
atttggattctttatctgatatctaaagattatgatttccttcagattggattaatggga
gcggtacttgaaattgctaagcttatatttgaagttccttccggcgtttttgctgatcgt
tatggaattaaaatttcaattgccagttcattctttttctccatccttacatgggccttc
ttcccttttatcgattcagctgctatttgcatactggctatgatcatatgggctttatca
gattccttaatttccggttcttttgaaacttggatgagccgtgtcgcaggggaagatcga
ttcggcaaagaaatgatgaaaaacacacaattgctaatcacttttttaattattggaagt
attgccagcgggtatttgtattcattaaatatctattttcctttcctgctcgttatggtg
atctacttattactatttatttggatgtctgtatttattaaagtcccttctgtttccgaa
acaaatcatggggatcagaaccaacatgattcgataaagattatcaaagaaagtttaaaa
attatctttaacaaaaaaagggttcttttaatcgtcatagccggtttctttacagccaca
gcctatgacacaatttcccgttactggcagccttttttgagtgatttaggcttttcagaa
aagtcactgggatatatttttgccctaggagggtttaccgctctcgttcttttgacatta
accatcaggttcgaaaagaagatcgaaaaaaatccatatctcgctttaacctcattggat
tccatgggcatggtcatgacttttctattgtctagagcattcaggccgctgggcattcca
tgtacagcgtttttgcttgcaattgaagatattcatcatccgatcgtaacaagttactta
aataagtttttccccgattcatacaagaacacacttttctcgttaaactcaggggtagga
gcaattggagaaattctttccggtgtcattttcggcatcatttccgcagcctttgggctc
tctgccatgtttgttgttgtagctgtatttctattaatccctattatcctttatacgata
gtgcctaagattaaagacaatgatatgaaagttcagattgaaaaatcccagcaagtgtaa

DBGET integrated database retrieval system