KEGG   Bacillus subtilis subsp. subtilis 168: BSU39940
Entry
BSU39940          CDS       T00010                                 

Symbol
yxaL
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PQQ_3 PQQ PQQ_2 APMAP_N DUF5074 SGL Tim17
Other DBs
NCBI-GeneID: 937661
NCBI-ProteinID: NP_391873
Pasteur: BG11114
BSORF: BG11114
UniProt: P42111 A0A6M3ZIX5
Position
complement(4102429..4103661)
AA seq 410 aa
MVKSFRMKALIAGAAVAAAVSAGAVSDVPAAKVLQPTAAYAAETVFSQNNGASGFLPGRY
DVQAMAPAMFNWSRESRFAGNTDGTLKWQNDIRTTPQNGAGAVIDGDGTVYLHSRDGEMK
AFNPDGSVKWVTGNLGKTYTQSPVLGTNGVIYLASYDKKIYFIDKETGEILTTVPLSGGP
SSETVIGSDGTLYFSTLDNYVHAIKPTSKSTWTERWKLKTNGVVSSVPVLAKNGTVYVGT
YNYVFYAINSGTGQVKWSRTTSNAFKGYPVIDKDGNIYAGNQDGQLYAYTSTGSLKWTFP
LNGFSSSSPAIDHNGNIYIGSGSGELFSISKNGDMNWSFYTDGPVRTAPLIDAKGTVYFG
SDDMKVYAADANGNELWSYQTDSNVVSSPQLAEDGTLYIGSYTKLMAFGK
NT seq 1233 nt   +upstreamnt  +downstreamnt
atggtcaagtcatttcgtatgaaagctttgattgcgggagctgcggtggcggcggctgtt
tcggccggcgctgtttctgatgtgcccgctgccaaagtgcttcagccgacagctgcttat
gcggcggaaacggtgttttctcaaaataatggagcatctggctttttgccaggaagatat
gatgtacaagcgatggcgcctgccatgtttaactggtcacgcgaaagccggttcgccgga
aatacagacgggacgctgaaatggcaaaacgacatcagaacgactccgcaaaatggagcg
ggggctgtgattgacggagacggcacagtatatcttcattccagagacggggaaatgaaa
gcctttaatccagacggctcagtcaaatgggtgacgggcaatcttggaaaaacatatacg
caatctcctgtacttgggaccaacggcgttatctatttggcatcctatgacaaaaagatt
tattttattgacaaagaaacgggagaaattttaacaacggttccgttaagcggcgggcca
agctctgaaacggtgatcggttcagacgggacgttgtatttctcaacacttgataattat
gttcacgcgatcaaaccgacgtcaaaatcaacctggacagagcgctggaagttgaaaaca
aatggggtcgtcagctctgtgccggtgcttgccaaaaacggcaccgtgtatgtcggcaca
tataattacgtgttttatgcgatcaactccggaaccggacaggtgaaatggtccagaacg
acgtcaaatgcgtttaaaggatatccggtgattgataaggacggaaacatttatgccggc
aaccaagatggacagctgtatgcttatacatcaacaggcagtttgaaatggacattcccg
ctaaacgggttctccagctcatctcctgcgattgatcataatggcaatatctacatcggc
tcaggaagcggcgagctgttttccatcagcaaaaacggggatatgaactggtcattctac
acagacggccctgtcagaacggcgccgctgattgacgcgaagggaacggtttatttcggg
tcagatgatatgaaggtttatgcggcagacgcaaacggcaatgaattatggagctatcaa
accgacagcaacgtcgtgtcttctcctcagctcgctgaggacggaacactttatattgga
agttatacgaagctgatggcttttgggaaataa

DBGET integrated database retrieval system