KEGG   Bacillus subtilis subsp. subtilis 168: BSU39950
Entry
BSU39950          CDS       T00010                                 

Symbol
yxaJ
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF5391 Cybc1_Eros MFS_1_like
Other DBs
NCBI-GeneID: 937687
NCBI-ProteinID: NP_391875
Pasteur: BG11112
BSORF: BG11112
UniProt: P42109 A0A6M3ZIF8
Position
complement(4103762..4104187)
AA seq 141 aa
MSKKNSVAIMTTISAFLFCAVIVAASLSPLAGTGAAANQFNSAGMWSAVGMILVLYFIPF
LVYMLGVDAMRYVMAVLCGFGLLIHLSSAGFILMFSFFSDHLLSEVIFVLGVSLAAAAVN
VIWFVAAFRSGAEKTSVNTLT
NT seq 426 nt   +upstreamnt  +downstreamnt
atgtcaaaaaaaaatagcgtggcgatcatgacaaccatttctgcgtttcttttttgcgcc
gtgattgtggcggcttcactttcgccgctggccggaacgggagcggcggccaatcagttt
aattcagctggcatgtggtcagctgtcggtatgatccttgtcttgtatttcattccattt
ctcgtttatatgctcggagtcgatgcaatgaggtatgtcatggcggtgctttgcggcttc
gggcttttgattcatttgtcttcggccggttttatcttgatgtttagtttctttagtgac
catctgctttctgaggtgatctttgttttgggagttagtctcgctgcggctgctgtcaac
gtcatttggtttgtggctgcatttcgatcgggtgctgaaaaaacgtccgtgaatactctt
acatag

DBGET integrated database retrieval system