KEGG   Bacillus subtilis subsp. subtilis 168: BSU39970
Entry
BSU39970          CDS       T00010                                 

Symbol
yxaH
Name
(RefSeq) hypothetical protein
  KO
K07148  uncharacterized protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    BSU39970 (yxaH)
SSDB
Motif
Pfam: DUF418
Other DBs
NCBI-GeneID: 937697
NCBI-ProteinID: NP_391877
Pasteur: BG11110
BSORF: BG11110
UniProt: P42107 A0A6M3ZIY9
Position
complement(4104929..4106137)
AA seq 402 aa
MSSLQPTLTNERIGVLDVLRGMAIFGILFVNLAHFSYPDMYLSMLGKENFFMDKWSEADF
AAADILKFFIQTKCILLFSFLFGFGMVVMMERAENKGKRFVPLYVRRLMALLLFGTIHAF
LIWDGDILTEYALLGFVLLLFRKAKPKTLLIWAVSLYLLFSIPFMLTSFDQSNGQEWVQA
VTQQAKQAIHVYGSGSLKDIAEQRIHDRLVYMSSNGMLTYNPLNYFFASIPYFSMFLLGA
AAAKSRYLHEPEKHRKGLKRLWMAGLVIGIGAQVLYSVTDKEICLLIGAPFLMFFYVTTV
VYLYHKTRVRTVLQSFSAVGRMAFTNYLMQSIVCTWIFYHYGLGLYGKVYPAAGVLITIA
VCAVQMVFSHLWLRVFRMGPFEWLWRSATYLSWQPIAKKTKV
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgtcttcattacagccgactttaacaaatgagcggatcggtgtgcttgatgtgctgaga
ggaatggcgattttcggcatcttatttgtcaatctggcacatttcagttatccggatatg
tatttgtctatgcttggaaaagagaattttttcatggataagtggtctgaagctgatttt
gccgccgcagacatactgaaattcttcattcaaacaaaatgtattttattgttttccttt
ttatttggatttggcatggttgtcatgatggagagagcagaaaacaaagggaaacggttt
gttccgttatatgtgagaaggttaatggcgcttctcttgtttggaacgattcatgccttt
ttgatatgggacggggatattttaacagaatatgccctgctcggatttgtcctgctcttg
tttcgaaaagcaaagccgaaaacactgctgatatgggcggtctctttgtatcttctgttt
tccattccgttcatgttgacaagttttgatcaatcaaacggacaggaatgggtacaagcg
gtaacacagcaggcaaaacaagcgattcatgtttatggaagcggcagcctgaaggatatt
gcagaacagcggatccacgaccgtcttgtttacatgtcttcgaatggcatgcttacgtat
aatccgctcaactacttctttgcatccattccatatttcagcatgtttttgctgggagct
gcggcagcaaaatcacggtatttgcatgaaccggaaaagcatcgcaaaggattaaaacga
ttatggatggctgggcttgtcatcggcatcggcgcccaggtgctgtacagtgtaacggat
aaagaaatatgtttgctgattggcgcgcctttcctcatgtttttctatgttacaacggtt
gtctatctttatcataaaacaagagtgagaacagtgctgcaatcattctccgctgttggg
aggatggcatttaccaattatttgatgcagtctattgtgtgtacttggattttttatcat
tacggcttgggcctgtatggaaaagtgtaccctgctgccggtgtgctcattacaattgct
gtttgtgccgttcaaatggtcttcagccacctttggcttcgtgtctttcggatggggccg
tttgagtggttgtggagaagcgctacgtatctgtcgtggcagcctattgcaaagaaaaca
aaagtctag

DBGET integrated database retrieval system