KEGG   Bacillus subtilis subsp. subtilis 168: BSU39980
Entry
BSU39980          CDS       T00010                                 

Symbol
qodI
Name
(RefSeq) quercetin 2,3-dioxygenase
  KO
K07155  quercetin 2,3-dioxygenase [EC:1.13.11.24]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU39980 (qodI)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.24  quercetin 2,3-dioxygenase
     BSU39980 (qodI)
SSDB
Motif
Pfam: Cupin_2 AraC_binding Cupin_3 ARD EutQ AraC_binding_2 MannoseP_isomer Cupin_1 JmjC_2 Ectoine_synth CENP-C_C 3-HAO DUF6016
Other DBs
NCBI-GeneID: 937689
NCBI-ProteinID: NP_391878
Pasteur: BG11109
BSORF: BG11109
UniProt: P42106 A0A6M3ZHT5
Structure
Position
complement(4106245..4107258)
AA seq 337 aa
MKTLCTHSLPKEKMPYLLRSGEGERYLFGRQVATVMANGRSTGDLFEIVLLSGGKGDAFP
LHVHKDTHEGILVLDGKLELTLDGERYLLISGDYANIPAGTPHSYRMQSHRTRLVSYTMK
GNVAHLYSVIGNPYDHAEHPPYASEEVSNERFAEAAAVADIVFLDEAKPACSAKLAELTE
LPDGAVPYVLESGEGDRLLTGDQLHRIVAAQKNTDGQFIVVSSEGPKGDRIVDHYHEYHT
ETFYCLEGQMTMWTDGQEIQLNPGDFLHVPANTVHSYRLDSHYTKMVGVLVPGLFEPFFR
TLGDPYEGHIFPCEPQALRFDRILQNIEALDLKVMKP
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaaaacattatgtacacattcattgcctaaagaaaaaatgccttatttgctccggagc
ggagaaggcgagcgctatctgttcggcagacaggttgccacggtgatggcgaatgggagg
agcacaggtgatttgtttgagatcgtgcttctttccgggggaaaaggagatgcctttccg
cttcacgtccacaaggacacacatgaaggaattctcgttttggacgggaaactggaactg
acacttgatggtgaacgctatttattaatatcaggtgattatgccaacattccggcggga
acaccgcacagctaccggatgcagagccacagaacaagactggtgtcttacacgatgaaa
ggaaacgtagcgcacttgtattccgttattgggaatccgtatgatcacgctgaacatccg
ccgtacgcaagcgaagaagtctcaaacgagcgatttgcagaagcagccgctgtagcggac
attgtatttctagatgaagcaaagcctgcatgttcggccaaattagcggaacttacagag
ctgccagatggagcggttccatacgttcttgaatctggagaaggagatcgtctgttgact
ggagatcagcttcaccgcattgtggctgcacaaaaaaatacagatggccagtttatcgtc
gtatcatctgaaggccctaaaggtgaccgaatcgttgatcactaccatgaatatcataca
gaaacattttattgccttgaaggccagatgacgatgtggacagatggccaggaaattcag
ctgaatccgggagatttcctgcatgtccctgcaaataccgttcactcctatcgccttgat
tctcactatacaaagatggtgggcgtattggttcctggtttatttgaaccgtttttccgg
acgttaggcgacccgtatgaaggccacatcttcccatgtgagcctcaggctttgcgcttt
gatcgcattttgcagaatatcgaagcattagatttaaaggtgatgaaaccataa

DBGET integrated database retrieval system