KEGG   Bacillus subtilis subsp. subtilis 168: BSU39990
Entry
BSU39990          CDS       T00010                                 

Symbol
yxaF
Name
(RefSeq) HTH-type transcriptional regulator YxaF
  KO
K18939  TetR/AcrR family transcriptional regulator, lmrAB and yxaGH operons repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU39990 (yxaF)
Transcription factors [BR:bsu03000]
 Prokaryotic type
  Helix-turn-helix
   TetR/AcrR family
    BSU39990 (yxaF)
SSDB
Motif
Pfam: TetR_N TetR_C_13 DUF4431
Other DBs
NCBI-GeneID: 937690
NCBI-ProteinID: NP_391879
Pasteur: BG11108
BSORF: BG11108
UniProt: P42105 A0A6M3ZI57
Structure
Position
complement(4107352..4107927)
AA seq 191 aa
MTSRGDSREKILHTASRLFQLQGYHATGLNQIVKESGAPKGSLYHFFPNGKEELAIEAVT
YTGKIVEHLIQQSMDESSDPVEAIQLFIKKTASQFDNTESIKGIPVGLLASETALISEPL
RTVCMKVFKSWEAVFARKLMENGFAEEEANQLGTLINSMIEGGIMLSLTNKDKTPLLLIA
EQIPVLVRKKG
NT seq 576 nt   +upstreamnt  +downstreamnt
atgactagcagaggagattcacgtgaaaaaatccttcacacggcgtcacgtctgttccag
ctgcaaggatatcacgcgacaggtttgaaccagattgtaaaagaaagcggtgctccaaaa
ggatcgctttatcacttttttccgaatggcaaagaagaactagcaattgaagcggttaca
tatacaggtaagatcgttgaacatctgatacagcaaagcatggatgaatcctctgatcct
gttgaagcgattcagctttttatcaaaaaaacagccagccaatttgacaacacagaaagc
attaaaggtattccagtcggtttgctggcgagtgagacagcgttaatcagtgaaccgctg
cggacggtttgcatgaaggtgtttaaaagctgggaagcggtttttgccagaaaattaatg
gaaaacggatttgcagaagaagaagcaaatcagcttggaacgctgattaattcgatgatt
gagggcggcatcatgctttcgttaacgaataaagacaaaacgcctcttcttctcattgcc
gaacaaataccagtgctggtgagaaaaaaagggtag

DBGET integrated database retrieval system