KEGG   Bacillus subtilis subsp. subtilis 168: BSU40000
Entry
BSU40000          CDS       T00010                                 

Symbol
yxnA
Name
(RefSeq) oxidoreductase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: adh_short adh_short_C2 KR NAD_binding_10 Epimerase Eno-Rase_NADH_b Shikimate_DH NmrA ADH_zinc_N 2-Hacid_dh_C CoA_binding_2 TLP1_add_C SEO_C TNFR_16_TM
Other DBs
NCBI-GeneID: 937698
NCBI-ProteinID: NP_391880
Pasteur: BG14165
BSORF: BG14165
UniProt: O32291 A0A6M3ZI84
Position
4108058..4109128
AA seq 356 aa
MTIDHSVTNTEQLEQQNPAIKTKLKLKKLKDQVIVITGASSGIGLVTARMAAEKGAKVVA
AARNEEALKELTDELKEKGHDAIWVKADVGKEEDVNRIAETAISTFGRFDTWVNNAAVST
FGHAMDVTVEDMKRMFDTNFWGPVYGTRAAVKHYTGRGVPGALINVGSLFGDRGTVIQST
YASAKFALHGWTESIRMELEKEQAPVSVTLIHPGRIDTPYNEHAHSYLDKQPAHYRSMIY
PPEAVAEAILFAAEHPKRDMYIGSQAKAIAMLGALFPRLTDRLMEKIMYHSQHAERPSNP
REESALYDAGCGMHDRGTNKGWMRSRSYYTKATKRPIVSAAVVAGLVAWAAAKRCR
NT seq 1071 nt   +upstreamnt  +downstreamnt
atgacaatcgatcattcagtcacaaatacagagcagcttgaacaacagaaccccgccata
aaaacaaagctcaaactgaaaaagcttaaggatcaggtgatcgtcattaccggcgcttca
agcggtatcggacttgtcacggcgagaatggcagctgaaaaaggcgcaaaggtcgtggca
gcagcgcgaaatgaagaggcgctgaaggagctcactgatgaacttaaggaaaaagggcac
gacgccatatgggtaaaggcggatgtcggaaaagaagaggacgtcaaccgcatcgcagaa
accgcgatcagcacattcggccgctttgatacatgggtcaacaatgcggccgtctcgact
ttcggacacgccatggacgtcaccgtcgaagacatgaagcgcatgttcgacacaaatttc
tggggacctgtttacggaacaagagcggctgtcaaacactacaccggcagaggtgtgccg
ggcgcactcattaatgtaggaagcctgttcggagacaggggaacggtcattcaatccaca
tatgcatctgccaaatttgcgcttcacggctggacggaaagcatccgaatggagcttgaa
aaggaacaggcgcccgtctcggtaacgctcatccacccgggcagaattgacacaccatat
aacgagcatgcgcacagctacctcgacaaacagccggctcattaccgctccatgatctat
ccgccggaagcggtcgccgaagcgatcctgtttgccgccgaacaccctaagcgcgacatg
tacatcggctcacaggccaaagccatcgccatgctgggcgcgctttttcctcgtctgacc
gacagactgatggaaaaaatcatgtatcacagccagcatgccgaaagaccgtccaatccg
agagaagaaagcgctctttatgatgctggctgcggtatgcatgacagaggcacaaataaa
ggatggatgaggtcaagaagctactacacaaaagcgacgaagcgcccaattgtatcggcg
gctgttgttgccggactagtggcttgggctgccgccaaacgatgcagataa

DBGET integrated database retrieval system