KEGG   Bacillus subtilis subsp. subtilis 168: BSU40010
Entry
BSU40010          CDS       T00010                                 

Symbol
yxaD
Name
(RefSeq) HTH-type transcriptional regulator YxaD
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: MarR MarR_2 HxlR HTH_5 HTH_24 HTH_42 HTH_34 HHH_4 HTH_27
Other DBs
NCBI-GeneID: 937699
NCBI-ProteinID: NP_391881
Pasteur: BG11106
BSORF: BG11106
UniProt: P42103 A0A6M3ZHX0
Position
complement(4109185..4109616)
AA seq 143 aa
MQNQNPVELIEYELTTFIRRAVYLDQSEKRTGNLERSSYLLLRQLDEFGPARVKELAESF
KLDISTLSRQAAALEAKELIYRFSDPSDGRVSLFTITKLGKQLLKADQQKRLERYEQMLK
EWSTQEKEMFGELLQRMNKAFID
NT seq 432 nt   +upstreamnt  +downstreamnt
ttgcaaaatcaaaatccagttgaattaattgaatatgagctgacgacttttatcaggaga
gctgtttatctggatcaatcggagaaaagaacagggaatttggagagatcttcgtactta
ttactgagacaattggatgagtttgggcctgctcgtgttaaggaattggctgaatcgttt
aagcttgatatttctactctttcaagacaagcagctgcattagaggcaaaggagctcatc
tatcgtttctcagacccgtctgatgggagagtcagcctgtttaccattacaaaactcggc
aaacaactattaaaagccgatcagcaaaagcgccttgaacgttatgaacagatgctgaaa
gaatggtcaacacaggaaaaagagatgttcggcgagctgctgcagcgtatgaacaaggct
tttatcgattaa

DBGET integrated database retrieval system