KEGG   Bacillus subtilis subsp. subtilis 168: BSU40021
Entry
BSU40021          CDS       T00010                                 

Symbol
yxzK
Name
(RefSeq) integral membrane protein YxzK
  KO
K06518  holin-like protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU40021 (yxzK)
Transporters [BR:bsu02000]
 Other transporters
  Pores ion channels [TC:1]
   BSU40021 (yxzK)
SSDB
Motif
Pfam: LrgA 2HCT DUF4668 DUF1418 Phage_holin_6_1 Brr6_like_C_C DUF6057
Other DBs
NCBI-GeneID: 8303163
NCBI-ProteinID: YP_003097798
UniProt: C0H3T7 A0A6M3ZI22
Position
4109843..4110247
AA seq 134 aa
MKVIRIILQVLILYVFFMIGEAIQHLFHLPVSGSIVGLVLLLICLGLRIVPVSIIEDGAG
FLLSFLPLLFIPAMTGVINYPSLISFNGLMLLITVVLSTIVTIIAAGFASQLLEKKAKKR
EEKEKCSKHVSRSL
NT seq 405 nt   +upstreamnt  +downstreamnt
gtgaaagtcatacgaattattttgcaagtgttgatattatatgtattttttatgatcggg
gaagccattcagcatctgtttcatttacccgtgtcaggaagcatcgttggattggtattg
cttctgatctgcttgggcctccgtattgttcccgtctccatcattgaagacggagcaggg
tttttattatccttccttccattgttgttcatcccggcaatgacaggagtgataaactat
ccgtctctcatttcattcaatggcctgatgctgctgattacagtcgttctcagcaccatc
gtcacgatcattgcggctggattcgccagccagctattagagaaaaaagcaaaaaaacgg
gaggagaaagagaaatgcagcaagcatgtatcgcgatcattataa

DBGET integrated database retrieval system