KEGG   Bacillus subtilis subsp. subtilis 168: BSU40030
Entry
BSU40030          CDS       T00010                                 

Symbol
yxaB
Name
(RefSeq) general stress protein 30
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: PS_pyruv_trans SOR
Other DBs
NCBI-GeneID: 937700
NCBI-ProteinID: NP_391883
Pasteur: BG11104
BSORF: BG11104
UniProt: P42101 A0A6M4JQY7
Position
complement(4110949..4111980)
AA seq 343 aa
MTVQEIKGKKLVKGIAPNVEPEALLNDKRKVFLFGSPSYTNIGDQAIAYAEEKFIKNHFP
YYEYIEIMDYATDEGIELVKEIIREDDIVCFTGGGNLGNLYLDIEEDRRKVFSAFKDYKS
ISLPQSVYFEDTEEGQKEKKKTQDAYHQNTNLTIAARETQTLDVVKETFNSNVIFTPDMV
LSLDIVPRELERDGVLFILRADKEKVTDEDFISQMKQWAEKTTYTERTDTVLDTVDTIDY
ADREKHFMEMLDRIGSSKLVITDRLHAMIFSIITKTPCLVFGNSYGKAKHSYRDWLESLN
FIEYTDKNDVEELERMIDRLLQAEPNDVDLSKDFQPLIDFFAS
NT seq 1032 nt   +upstreamnt  +downstreamnt
atgactgtacaagaaatcaaaggcaaaaaactagtaaaaggcattgcgccaaatgtggag
ccggaagctctgttaaatgataaacgaaaagtatttttgtttggttcccctagctacaca
aacattggcgaccaagcgattgcgtatgcggaagagaaatttatcaaaaatcattttccg
tattatgaatacattgagattatggattatgcgacggatgagggcattgaactggtgaag
gagatcattcgtgaagacgatattgtctgctttacaggcggagggaatttaggaaacctt
tatctcgatattgaggaagacagaagaaaggtcttttcggcgtttaaagactacaaatca
atttctctgccacaatccgtttattttgaggatacagaggaaggacagaaggaaaagaaa
aaaacacaggatgcgtaccatcaaaatacaaacttaacgattgctgcgcgtgagacgcaa
acactggatgttgtgaaagagaccttcaactccaatgtgatctttacaccggacatggtg
ctttccttggatattgtgccgcgagagctcgagcgggacggcgttctctttattttaaga
gcggataaggagaaagtgactgacgaagattttatttcacagatgaagcaatgggcagaa
aaaacaacttacacagagcgtaccgatacggtgctggatacggtagacaccatcgattac
gctgatcgtgaaaagcattttatggagatgctggaccgcatcggctccagtaaattggtg
attaccgaccgccttcacgcgatgattttctcgattatcaccaaaacaccttgccttgtc
tttggaaacagctatggcaaagccaaacattcatatcgggattggcttgaaagcttaaac
ttcattgaatatacggataagaatgatgttgaggagctggagcgtatgattgaccgcctg
cttcaagcagaaccgaatgacgttgatttatctaaggactttcagccgttgattgatttt
tttgcttcttaa

DBGET integrated database retrieval system