KEGG   Bacillus subtilis subsp. subtilis 168: BSU40040
Entry
BSU40040          CDS       T00010                                 

Symbol
glxK
Name
(RefSeq) glycerate kinase
  KO
K00865  glycerate 2-kinase [EC:2.7.1.165]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00260  Glycine, serine and threonine metabolism
bsu00561  Glycerolipid metabolism
bsu00630  Glyoxylate and dicarboxylate metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    BSU40040 (glxK)
  09103 Lipid metabolism
   00561 Glycerolipid metabolism
    BSU40040 (glxK)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    BSU40040 (glxK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.165  glycerate 2-kinase
     BSU40040 (glxK)
SSDB
Motif
Pfam: Gly_kinase TPP_enzyme_M_2
Other DBs
NCBI-GeneID: 937708
NCBI-ProteinID: NP_391884
Pasteur: BG11103
BSORF: BG11103
UniProt: P42100 A0A6M4JR29
Position
complement(4112073..4113221)
AA seq 382 aa
MKIIIAPDSFKESLSALEAAEAIERGFKSVFPGADYRKLPVADGGEGTVQSLVDATNGRI
IEQVVTGPLGEPVRAFFGMMGDGRTAVIEMAAASGLHLVPVDKRNPLITTTRGTGELIGA
ALDAGAERLIIGIGGSATNDGGAGMIQALGGRLLDNSGSEIGPGGGALSQLASIDVSGLD
SRLRNVKLEVACDVDNPLTGPKGATAVFGPQKGATADMLDVLDQNVSHFADMAEKALGST
FRDTEGAGAAGGLGWSLLTYLQADLKRGIDIVLEAVDFESIVQDADLVITGEGRIDSQTV
HGKTPIGVAKAAKSYDVPVIGIAGSISRDSNAVYQHGIDALFSIVPGAVPLEDAFEHAAE
YMERTARDIAASIKLAKTMFLI
NT seq 1149 nt   +upstreamnt  +downstreamnt
atgaaaatcatcattgcacctgattcttttaaggaaagcttatcagctctggaggcagcc
gaagcgatagaaagaggtttcaaatcggtctttccgggtgctgattacagaaaattgccg
gtggcggatggcggcgagggaaccgttcaatctctggtcgatgcgaccaatggaaggatc
atagagcaagttgtcacagggccgctgggggaaccggtgagagctttctttggcatgatg
ggagatgggagaacagctgtgattgaaatggctgctgcttcagggctgcatctggtgcct
gtagataagcgaaatccgctcatcactacaacaaggggaacgggagaattaatcggagca
gctcttgatgcgggagcggagcgattgatcatcggaatcggcggaagcgccacgaacgac
gggggagccgggatgattcaggcattgggcggaaggcttcttgataactcaggcagcgag
attggcccagggggcggcgcgttatctcagcttgcatcaatagatgtgagcgggcttgat
tccagattgcggaatgtcaaactggaagttgcctgtgacgtggacaatccgttaacagga
ccaaagggtgctacggctgttttcgggccgcaaaaaggcgcgacggccgacatgttggat
gtactagaccagaacgtaagccatttcgctgatatggcagaaaaagcgctcggatcaacc
ttccgagatacagagggcgccggtgcagcgggcggtcttggatggagcctgctaacttat
cttcaggctgacctgaaaagaggcattgatattgtccttgaagcggttgattttgaaagt
atcgttcaggatgcagaccttgtgattaccggcgagggacgaatcgacagccaaacggtt
catggaaaaacaccgatcggggtggccaaggccgctaaatcatacgatgtgcccgttatc
ggcattgcgggatcaatttcccgagacagtaatgccgtctatcaacacggaatcgatgcg
cttttcagcatcgtccccggagccgtgccactagaagacgcgtttgaacatgccgcggaa
tatatggaaagaacggcgcgggacattgcagcgtctatcaaattggcgaaaacgatgttt
ctgatatag

DBGET integrated database retrieval system