KEGG   Bacillus subtilis subsp. subtilis 168: BSU40050Help
Entry
BSU40050          CDS       T00010                                 

Gene name
gntR
Definition
(RefSeq) gluconate operon transcriptional repressor
  KO
K11476  GntR family transcriptional regulator, gluconate operon transcriptional repressor
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:bsu03000]
    BSU40050 (gntR)
Transcription factors [BR:bsu03000]
 Prokaryotic Type
  Helix-turn-helix
   GntR family
    BSU40050 (gntR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GntR FCD HTH_41 Latexin HTH_11 HTH_20
Motif
Other DBs
NCBI-GeneID: 937710
NCBI-ProteinID: NP_391885
Pasteur: BG10648
BSORF: BG10648
UniProt: P10585
Position
4113417..4114148
Genome map
AA seq 243 aa AA seqDB search
MLDSKDLLYPAKWLSKASTGVRVAYELRMRIVSGLIESGTILSENTIAAEFSVSRSPVRE
ALKILASEKIIRLERMGAVVIGLTEKKIAEIYDVRLLLETFVFERLVKIDIEPLVKDLSK
ILEMMKVSIKYEDADEFSFQDVLFHETIIRAIDHSYIQMIWNNLKPVMESFILLSMRVRL
KEKYEDFTRILDNHELYIQAIKTKDRALMIQSLHQNFDDVQDKVEDLWLSQQMLAKGAEY
NND
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgctagactccaaagacctgttgtatcccgcaaaatggctctcaaaagcgtcaaccgga
gttcgtgtcgcatacgagctgagaatgcggatcgtttcaggtctgattgaaagcggtacc
attttatcagaaaatacaatcgccgccgagttttcagtaagccgttcgccggttcgcgaa
gcgctaaaaatactcgcatccgaaaaaatcatccgcttagaacgaatgggagcggtcgta
attggtttaactgagaagaaaatcgcggaaatttatgatgtgcggttactattagaaaca
tttgtctttgaacggcttgtcaaaatagacattgagcctttagttaaggatctcagcaaa
attcttgaaatgatgaaagtctcaatcaaatatgaggatgctgacgaattttcatttcaa
gatgtgctgttccatgaaacgattatccgagcgattgatcattcatacattcagatgatc
tggaacaatctaaaacccgtcatggaaagctttattcttttatcgatgcgggtacggtta
aaggaaaagtatgaagacttcacaaggattttagataaccacgagctttatattcaagcc
atcaaaacaaaggatagggcgctgatgattcagtctcttcaccaaaactttgatgatgtg
caggataaggtagaagacctatggctctcacaacaaatgctggcaaaaggagctgaatac
aacaatgactag

DBGET integrated database retrieval system