KEGG   Bacillus subtilis subsp. subtilis 168: BSU40060
Entry
BSU40060          CDS       T00010                                 

Symbol
gntK
Name
(RefSeq) gluconokinase
  KO
K25031  gluconokinase [EC:2.7.1.12]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU40060 (gntK)
Enzymes [BR:bsu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.12  gluconokinase
     BSU40060 (gntK)
SSDB
Motif
Pfam: FGGY_N FGGY_C BcrAD_BadFG ROK MutL
Other DBs
NCBI-GeneID: 937713
NCBI-ProteinID: NP_391886
Pasteur: BG10649
BSORF: BG10649
UniProt: P12011 A0A6M3ZIZ8
Position
4114141..4115682
AA seq 513 aa
MTSYMLGIDIGTTSTKAVLFSENGDVVQKESIGYPLYTPDISTAEQNPEEIFQAVIHTTA
RITKQHPEKRISFISFSSAMHSVIAIDENDKPLTPCITWADNRSEGWAHKIKEELNGHEV
YKRTGTPIHPMAPLSKIAWITNERKEIASKAKKYIGIKEYIFKQLFNEYVIDYSLASATG
MMNLKGLDWDEEALRIAGITPDHLSKLVPTTEIFQHCSPEIAIQMGIDPETPFVIGASDG
VLSNLGVNAIKKGEIAVTIGTSGAIRTIIDKPQTDEKGRIFCYALTDKHWVIGGPVNNGG
IVLRWIRDEFASSEIETATRLGIDPYDVLTKIAQRVRPGSDGLLFHPYLAGERAPLWNPD
VRGSFFGLTMSHKKEHMIRAALEGVIYNLYTVFLALTECMDGPVTRIQATGGFARSEVWR
QMMSDIFESEVVVPESYESSCLGACILGLYATGKIDSFDAVSDMIGSTYRHTPIEDSAKE
YRTLMPIFINLSRLLENQYTQIADYQRGLITHK
NT seq 1542 nt   +upstreamnt  +downstreamnt
atgactagttatatgttaggaatcgatatcggcacgacaagcacaaaagctgtgctgttc
agtgaaaacggagatgtggtacagaaagaaagcatcggctacccgctctatacaccggac
atctcaacagctgaacaaaatccggaagagatttttcaggcagtcatccatacaacagcg
agaattacaaaacagcatcccgaaaaacggatctctttcatttcgttcagcagcgccatg
cacagcgtcattgcaatcgacgaaaatgacaagccgctgacgccatgcattacatgggcc
gacaacagaagtgaaggctgggcgcataagatcaaagaggaattgaacggacatgaggtg
tacaaacggacgggaacaccgattcatccgatggcaccgttaagtaaaattgcctggatc
acgaatgaaagaaaagaaatcgcttccaaggcaaaaaaatatatcggcatcaaagaatac
atttttaaacagctgttcaatgagtatgtcatcgattactcattggcatcagcgacaggc
atgatgaacctgaagggcttggattgggacgaagaggcactgcgcatcgcaggcatcacg
ccggatcacttatccaaactcgtgccgacaaccgagatctttcagcactgcagcccggaa
atagcgatccaaatgggaatcgatccggaaacgccttttgtcatcggcgccagcgacggc
gtgctgtccaacctcggcgtcaacgccattaaaaagggtgaaatcgccgtcaccatcggt
acaagcggtgccattcggacgattattgacaagccgcaaaccgatgaaaaagggagaatt
ttttgctatgccttgacggacaagcattgggttattgggggacctgtgaacaatgggggc
atcgtccttcgctggatcagagacgagtttgcctcctccgaaatcgaaacagcgacacgg
ctgggcattgatccatatgacgtgctgacgaaaattgcccaacgcgtcagacccggttct
gacggtctgctgttccacccatatctcgccggagaacgcgctccgttgtggaatccggat
gtacgcggctcatttttcggcttgaccatgtcgcataagaaagagcatatgatacgcgcg
gcattggaaggcgtcatttacaacctgtacacggtgttcttggcgttaactgaatgcatg
gatggcccggtaacccgcatccaagcgacagggggttttgcaaggtcggaggtttggcgc
caaatgatgtcggatatcttcgaatcagaggttgtcgttccggaaagctacgaaagctca
tgtctcggcgcctgcattttaggcctgtatgcaacaggaaaaatcgattctttcgacgcc
gtgtccgatatgatcggcagcacatacagacatacgccgatcgaagactcagccaaggaa
tacagaacattaatgccgattttcatcaatctatcaagattattagaaaatcaatataca
caaattgcagattatcagaggggcttaatcacacacaaatag

DBGET integrated database retrieval system