KEGG   Bacillus subtilis subsp. subtilis 168: BSU40070
Entry
BSU40070          CDS       T00010                                 

Symbol
gntP
Name
(RefSeq) gluconate permease
  KO
K03299  gluconate:H+ symporter, GntP family
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU40070 (gntP)
Transporters [BR:bsu02000]
 Other transporters
  Electrochemical potential-driven transporters [TC:2]
   BSU40070 (gntP)
SSDB
Motif
Pfam: GntP_permease CitMHS
Other DBs
NCBI-GeneID: 937715
NCBI-ProteinID: NP_391887
Pasteur: BG10650
BSORF: BG10650
UniProt: P12012 A0A6M3ZHU7
Position
4115711..4117057
AA seq 448 aa
MPLIIVALGILALLFLIMGLKLNTFISLLVVSFGVALALGMPFDKVVSSIEAGIGGTLGH
IALIFGLGAMLGKLIADSGGAQRIAMTLVNKFGEKNIQWAVVIASFIIGIALFFEVGLVL
LIPIVFAISRELKISILFLGIPMVAALSVTHGFLPPHPGPTAIAGEYGANIGEVLLYGFI
VAVPTVLIAGPLFTKFAKKIVPASFAKNGNIASLGTQKTFNLEETPGFGISVFTAMLPII
IMSVATIIDLLQETIGFADNGVLAFIRLIGNASTAMIISLLVAVYTMGIKRNIPVKTVMD
SCSTAISQIGMMLLIIGGGGAFKQVLINGGVGDYVADLFKGTALSPIILAWLIAAILRIS
LGSATVAALSTTGLVIPLLGHSDVNLALVVLATGAGSVIASHVNDAGFWMFKEYFGLSMK
ETFATWTLLETIISVAGLGFILLLSLVV
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgccgttaatcatcgttgcacttgggatcttagcattactatttctgattatgggctta
aaattaaacacatttatttccctgctggtcgtatcgttcggcgtggcactggcactcggg
atgccgttcgataaagttgtcagctccatcgaagcaggaataggggggactcttggccac
atcgcgctcatcttcggactcggtgcgatgctgggcaaactgatcgcggattcaggaggc
gcacagcgcattgcgatgacgctcgtcaacaaattcggtgagaaaaatattcaatgggcc
gttgtcattgcctcattcattattgggattgcgttattttttgaagtaggactggttcta
ttaattccgattgtctttgcgatttcaagagaattgaagatttctattttatttctcgga
atcccgatggtcgcggcactatccgtcacacacggtttcctgccgccgcacccgggacct
acggcgatcgccggtgagtatggcgcaaacattggagaagtgctgctgtacggctttatc
gttgctgttccgacagtgctcattgcagggccgttatttacaaagttcgcgaaaaaaatc
gttcctgcatcatttgcgaaaaacggcaatattgcatcactcggcacacaaaaaacattt
aaccttgaagaaacacccggctttggaatcagtgtctttactgcaatgctcccgattatc
atcatgtcggtcgcgaccattatcgacctgcttcaagaaacaatcgggtttgcagataac
ggagttttagcttttatcagattgattggaaacgcatcgactgctatgattatttcgtta
ttggtcgcagtctatacaatgggcatcaagcgcaacattccagtcaaaaccgtgatggat
tcttgttcaactgccatttcacaaatcggcatgatgcttttgatcatcggaggaggcggc
gccttcaaacaagtgctgatcaacggcggtgtcggcgattacgtagcagacttattcaaa
ggaacggcattatcgccaatcattctggcatggctcatcgcagcgatcctgcgcatttct
ctaggatcggcgactgttgccgcactaagcacaacaggtctggtcattccgttattgggc
cattctgatgttaacctggcgttagtcgtactcgcaacaggagccggaagtgtcatcgct
tcacacgtcaatgacgccggcttctggatgttcaaggaatacttcggattaagcatgaaa
gaaacattcgccacatggacattgctggaaaccattatttccgttgctggactgggattc
attttattgttaagtttagttgtatga

DBGET integrated database retrieval system