KEGG   Bacillus subtilis subsp. subtilis 168: BSU40080
Entry
BSU40080          CDS       T00010                                 

Symbol
gntZ
Name
(RefSeq) 6-phosphogluconate dehydrogenase
  KO
K00033  6-phosphogluconate dehydrogenase [EC:1.1.1.44 1.1.1.343]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu00030  Pentose phosphate pathway
bsu00480  Glutathione metabolism
bsu01100  Metabolic pathways
bsu01110  Biosynthesis of secondary metabolites
bsu01120  Microbial metabolism in diverse environments
bsu01200  Carbon metabolism
Module
bsu_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
bsu_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    BSU40080 (gntZ)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    BSU40080 (gntZ)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.44  phosphogluconate dehydrogenase (NADP+-dependent, decarboxylating)
     BSU40080 (gntZ)
    1.1.1.343  phosphogluconate dehydrogenase (NAD+-dependent, decarboxylating)
     BSU40080 (gntZ)
SSDB
Motif
Pfam: 6PGD NAD_binding_2 3HCDH_N NAD_Gly3P_dh_N Shikimate_DH ApbA 2-Hacid_dh_C F420_oxidored PGK IlvN
Other DBs
NCBI-GeneID: 937716
NCBI-ProteinID: NP_391888
Pasteur: BG10651
BSORF: BG10651
UniProt: P12013 A0A6M4JR43
Position
4117080..4118486
AA seq 468 aa
MFNSIGVIGLGVMGSNIALNMANKGENVAVYNYTRDLTDQLIQKLDGQSLSPYYELEDFV
QSLEKPRKIFLMVTAGKPVDSVIQSLKPLLEEGDVIMDGGNSHYEDTERRYDELKEKGIG
YLGVGISGGEVGALTGPSIMPGGDRDVYEKAAPILTKIAAQVGDDPCCVYIGPKGAGHFT
KMVHNGIEYADMQLIAEAYTFLRETLRLPLDEIASIFETWNQGELKSYLIEITAEILRKK
DEKTGQPLIDVILDKTGQKGTGKWTSMQAIDNGIPSTIITESLFARYLSSLKEERMAAQD
VLAGPEAEEKHLDKDTWIEYVRQALYMGKVCAYAQGFAQYKMSSELYGWNLPLKDIALIF
RGGCIIRADFLNVISEAFSEQPNLANLLIAPYFTDKLHAYQTGLRKVVCEGISTGISFPC
LTTALSYYDGYRTGRSNANLLQAQRDYFGAHTYERTDMDGVFHTNWSE
NT seq 1407 nt   +upstreamnt  +downstreamnt
atgttcaattcgattggtgtcataggcttaggcgtaatgggaagcaacatcgccttaaac
atggcaaataaaggcgaaaacgtcgctgtctataattacaccagagatttaacggaccag
cttatccaaaagctggatggacaatctctcagcccgtattacgagcttgaggactttgtt
caatcgttagaaaaaccaagaaaaatctttttgatggtcacagcgggaaaacccgtagat
tccgtcatccaatcattaaagcctttgcttgaagaaggcgacgtcatcatggacggagga
aactcccactatgaagacacagaaagaagatatgacgagctgaaggaaaaagggatcggc
tacctgggagtcggcatttccggcggtgaagtcggtgcgttaacagggccttccatcatg
ccgggcggagatcgcgacgtctatgagaaagccgctcctatcctgacgaaaatcgcagcc
caagtcggagatgacccttgctgtgtctatatcggaccaaaaggggcagggcactttaca
aaaatggtgcacaacggcattgaatatgccgacatgcagctgattgcagaagcttatacg
tttctaagagaaacgcttcgtctgccgctagatgaaattgcatctatttttgaaacatgg
aatcaaggtgagctgaaaagctatttaatagagattacagctgagattttacgcaaaaaa
gacgaaaaaacaggacagcctctgatcgatgtcatccttgataaaaccggccaaaaaggc
accggaaaatggacgagcatgcaggcgattgataacggcatcccgtccacgatcatcaca
gagtccttgttcgcccgctacttgtcatctttaaaagaagaacggatggcagctcaagat
gtattagcaggcccggaagccgaagaaaaacacttggataaagacacttggattgaatac
gtcagacaggctctttacatggggaaagtatgcgcctatgcacaaggctttgcccaatat
aagatgtcatctgagctttacggctggaatctgccgctcaaagacatcgccttgattttc
cgaggcggctgcatcatccgcgctgatttcctaaacgtgatcagcgaagcattcagtgag
cagccaaatctggctaacctgctgatcgcgccttatttcacagataagctccatgcctat
caaacaggcctgcgaaaagtcgtttgcgagggtatcagcaccggaatctctttcccatgc
ttaactaccgcgctctcttattacgacggctaccgcacagggcgttccaatgcgaacctc
ttgcaggcacagcgcgattactttggcgctcacacgtacgaacggactgatatggacggc
gtcttccatacgaattggtctgaataa

DBGET integrated database retrieval system