KEGG   Bacillus subtilis subsp. subtilis 168: BSU40090
Entry
BSU40090          CDS       T00010                                 

Gene name
ahpC
Definition
(RefSeq) alkyl hydroperoxide reductase subunit C
  KO
K24119  NADH-dependent peroxiredoxin subunit C [EC:1.11.1.26]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    BSU40090 (ahpC)
Enzymes [BR:bsu01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.26  NADH-dependent peroxiredoxin
     BSU40090 (ahpC)
SSDB
Motif
Pfam: AhpC-TSA Redoxin 1-cysPrx_C SCO1-SenC
Other DBs
NCBI-GeneID: 938147
NCBI-ProteinID: NP_391889
Pasteur: BG11385
BSORF: BG11385
UniProt: P80239 A0A6M4JQZ3
Position
4118950..4119513
AA seq 187 aa
MSLIGKEVLPFEAKAFKNGEFIDVTNEDLKGQWSVFCFYPADFSFVCPTELEDLQEQYAA
LKELGVEVYSVSTDTHFVHKGWHDSSEKISKITYAMIGDPSQTISRNFDVLDEETGLADR
GTFIIDPDGVIQTVEINAGGIGRDASNLVNKVKAAQYVRQNPGEVCPAKWEEGGETLTPS
LDLVGKI
NT seq 564 nt   +upstreamnt  +downstreamnt
atgtctttaatcggtaaagaagtacttccattcgaagcaaaagcattcaaaaacggtgaa
ttcatcgatgtaacaaacgaagatttgaaaggccaatggagcgtattctgcttctaccca
gcagatttctctttcgtatgcccaactgagcttgaagatcttcaagaacaatatgctgca
cttaaagaattaggtgttgaagtatactctgtttctacagatactcacttcgtacacaaa
ggctggcatgacagctctgaaaaaatcagcaaaatcacttacgcaatgatcggtgaccca
tctcaaacgatctctcgcaacttcgatgttcttgacgaagaaactggccttgctgaccgc
ggaacattcatcatcgatccagacggcgttatccaaactgttgaaatcaatgcaggcggt
atcggccgtgacgcaagcaaccttgtaaacaaagtaaaagcagctcaatacgttcgtcaa
aacccaggtgaagtttgcccggctaaatgggaagaaggcggcgaaactcttacacctagc
cttgatctagtaggtaaaatctaa

DBGET integrated database retrieval system