KEGG   Bacillus subtilis subsp. subtilis 168: BSU40140Help
Entry
BSU40140          CDS       T00010                                 

Gene name
yydJ
Definition
(RefSeq) peptide export permease protein YydJ
  KO
K16916  putative peptide transport system permease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00583  Putative peptide transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU40140 (yydJ)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU40140 (yydJ)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative peptide transporter [MD:M00583]
    BSU40140 (yydJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-GeneID: 937730
NCBI-ProteinID: NP_391894
Pasteur: BG11483
BSORF: BG11483
UniProt: Q45592
Position
complement(4124220..4124942)
Genome map
AA seq 240 aa AA seqDB search
MKLEFKKSISNKVIIILGAMFVFLFLLGYFLLVGIDKVSNVTPEMFFFSSYTVATQFGLM
LFSFVIAFFINREYSNKNILFYKLIGENIYTFFYKKIAVLFLECFAFITLGLLIISLMYH
DFSHFALLLFLFSAVILQYILIIGTISVLCPNILISIGVSIVYWMTSVILVAISNKTFGF
IAPFEAGNTMYPRIERVLQSDNMTLGSNDVLFIILYLVSIIIINAIVLRFSKTRWIKMGL
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagagtttaaaaagagtattagcaacaaagttatcattattttaggagcaatg
tttgtatttttatttttgctgggttattttttacttgttggaatcgataaagtcagtaat
gttacacctgaaatgtttttctttagctcctatactgttgcgacccagtttggtttgatg
ttattttcatttgttatagctttctttattaatagagagtattcaaacaaaaatattctc
ttttacaagttaattggagagaacatctatactttcttttataaaaagatagctgtttta
tttttagaatgttttgcatttataacgctaggcctgctaatcatatcgttgatgtaccat
gatttttcgcattttgcattattactttttttattttctgcagttatactgcagtatatt
ctaattatcggaactataagcgtgttatgtcctaatatattaattagtataggtgtcagt
atcgtttattggatgacttctgttatcttagtagctataagcaataaaacgtttggtttc
attgctccttttgaggcaggtaacactatgtacccccgaatagaaagagtgctgcaatct
gataacatgacacttgggagtaatgatgttttatttattattttgtatttagtttcaatt
attatcataaatgcgattgtccttcgcttttctaaaactagatggatcaaaatgggcctt
taa

DBGET integrated database retrieval system