KEGG   Bacillus subtilis subsp. subtilis 168: BSU40150Help
Entry
BSU40150          CDS       T00010                                 

Gene name
yydI
Definition
(RefSeq) peptide export ATP-binding protein YydI
  KO
K16917  putative peptide transport system ATP-binding protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Pathway
bsu02010  ABC transporters
Module
bsu_M00583  Putative peptide transport system
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    BSU40150 (yydI)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:bsu02000]
    BSU40150 (yydI)
Transporters [BR:bsu02000]
 ABC Transporters, Prokaryotic Type
  ABC-2 type and other transporters
   Putative peptide transporter [MD:M00583] [OT]
    BSU40150 (yydI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 SMC_N NB-ARC AAA_22 ATPase Bac_DNA_binding RsgA_GTPase
Motif
Other DBs
NCBI-GeneID: 937743
NCBI-ProteinID: NP_391895
Pasteur: BG11482
BSORF: BG11482
UniProt: Q45593
Position
complement(4124963..4125592)
Genome map
AA seq 209 aa AA seqDB search
MNIANYTLKVKGKTLLQDTDLHFSSGKINHVVGKNGVGKSQLAKDFLLNNSKRIGRDIRQ
NVSLISSSSNIPNDVSKDFLLHFLSKKFDAKMIDKIAYLLNLDNIDGKVLIKNLSDGQKQ
KLKLLSFLLEDKNIIVLDEITNSLDKKTVIEIHGFLNKYIQENPEKIIINITHDLSDLKA
IEGDYYIFNHQEIQQYHSVDKLIEVYINE
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagcgaattacactttaaaagtgaaaggcaaaacgttacttcaggacaccgac
ttgcatttttcgagcgggaaaattaatcacgttgtcggaaaaaatggagtcggtaaatca
cagcttgctaaagactttttgttgaataatagcaaaagaatcggcagagatattcgtcaa
aatgtttctttaatatccagctcgtcgaatatacctaatgatgtttctaaggacttttta
ttacactttttgagtaaaaaatttgatgcaaaaatgatagataaaatcgcatatttactt
aatctggataatattgatggaaaagttctgatcaaaaatttgagtgatggacaaaagcaa
aaattaaaattgctcagtttcttattagaggataaaaatattattgttttagatgaaata
acgaattcattagacaaaaaaacggttatagagattcatggcttcttaaacaagtatatt
caggagaaccccgagaagattatcatcaacattacacatgatttgtctgatttaaaggcg
atagaaggggattattatatatttaatcaccaagaaattcaacaatatcattcagtggat
aaattaattgaagtgtatataaatgagtaa

DBGET integrated database retrieval system