KEGG   Bacillus subtilis subsp. subtilis 168: BSU40160
Entry
BSU40160          CDS       T00010                                 

Symbol
yydH
Name
(RefSeq) peptide zinc metalloprotease protein YydH
  KO
K16922  putative peptide zinc metalloprotease protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:bsu01002]
    BSU40160 (yydH)
Peptidases and inhibitors [BR:bsu01002]
 Metallo peptidases
  Family M50: S2P protease family
   BSU40160 (yydH)
SSDB
Motif
Pfam: DUF3267 Peptidase_M50
Other DBs
NCBI-GeneID: 937745
NCBI-ProteinID: NP_391896
Pasteur: BG11481
BSORF: BG11481
UniProt: Q45594 A0A6M3ZJ09
Position
complement(4125742..4126500)
AA seq 252 aa
MKILKYEDEKYEVLVQNNVFIKDKKSGEYYKNSLNSLSDKQLLRFKMYKEKVSPKFFYLF
LSFTALMFILNYIHLIKLQNGLSSVFYGWKMWIIIVIYFIMNIVLHELGHIYSLKFFGKN
FDKVGFKLNFYVFPAFYVQLNETYMLSRNEKIIVHLFGLFINYLLINTLELINQFTFSSE
ALTMAFMLFSSTLLWNLIPILNSDGYKILLAFLSLDEYSRFKTNHWLVLTIQIIGIGLAV
NSVVHWILYIVN
NT seq 759 nt   +upstreamnt  +downstreamnt
atgaaaattttaaagtatgaagatgaaaaatatgaagtgcttgtgcaaaacaacgtattt
ataaaagacaaaaaaagcggagaatactataaaaatagtttaaattctctgtcagataaa
caattattacgttttaaaatgtataaagagaaagtatcaccaaagtttttttatctgttc
ttatcctttacggctctcatgttcatattaaattatattcatttaataaaattgcaaaat
ggattgtcctcagtattttacggctggaaaatgtggataattatagttatttattttata
atgaatatagtgcttcatgaactgggacatatttattccttaaaatttttcgggaaaaac
tttgataaagtgggattcaaactgaatttttatgtatttcctgctttttatgtccaattg
aatgaaacctacatgctatcaagaaatgaaaagataatcgttcatttatttggcttgttt
atcaattatcttttaataaatacattagaattaataaatcaatttacattttccagtgaa
gcattaactatggcatttatgcttttctcgtctactttattgtggaacttaatcccaata
ttgaattctgatggttacaaaattcttttagcttttctgagcttagatgaatatagccgt
tttaagacaaatcattggttagttcttacgattcaaattatagggattggccttgcagtg
aattcagttgtacattggatattatatattgtaaactag

DBGET integrated database retrieval system