KEGG   Bacillus subtilis subsp. subtilis 168: BSU40170
Entry
BSU40170          CDS       T00010                                 

Symbol
yydG
Name
(RefSeq) peptide biosynthesis protein YydG
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Radical_SAM Fer4_14 Fer4_12 SPASM
Other DBs
NCBI-GeneID: 937720
NCBI-ProteinID: NP_391897
Pasteur: BG11480
BSORF: BG11480
UniProt: Q45595 A0A6M3ZHV5
Position
complement(4126481..4127440)
AA seq 319 aa
MYNKTVSINLDSRCNASCDHCCFSSSPTSTTRMEKEYIRELVTEFAKNKTIQVISFTGGE
VFLDYKFLKELMEIIKPYEKQITLISNGFWGLSKKKVQEYFHDMNSLNVIALTISYDEYH
APFVKSSSIKNILEHSRKYPDIDISLNMAVTKDKMSNHILEELGDSILGVKITKFPMISV
GAAKTRIKQENIHKFYSLEDEDSLHCPGYDIVYHHDGEIYPCCSPAIFETKITLREEYNQ
SFERTVEKLNSNLLLFILRKEGFKWFLNILKENNKIEEFDIPYEFSSICGVCGSLFNSAE
KINYFYPYMEKYYNENFKV
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtataataaaacagtatcaatcaatttagattcaaggtgtaatgcatcctgtgaccat
tgttgtttttctagttcaccaacttcaacaaccaggatggaaaaagaatacataagagag
ttagtaactgaatttgcaaaaaacaaaaccattcaagtgatttcttttacaggtggggaa
gtttttttagattataaatttttaaaagaactaatggaaatcattaaaccatatgaaaaa
caaataacgttgatctctaatggattttggggtttgagcaagaaaaaggtccaggagtac
tttcatgatatgaattctttaaatgtgatagcactgactataagttatgatgagtaccat
gctccatttgtcaagtcttccagtattaaaaacatattagaacatagcaggaaataccct
gatatcgatatttctcttaatatggcagttaccaaagacaaaatgtccaaccacatttta
gaggaattgggggattcaatcttaggtgtaaagataacaaaatttccaatgatatcagtt
ggcgctgctaaaactagaattaagcaagaaaacatacataaattttacagtcttgaagat
gaagattccttacattgtcccggatatgacattgtatatcatcatgatggagaaatttat
ccatgttgttcccctgctatttttgaaacgaaaataaccctaagggaagaatataaccaa
agtttcgaaagaaccgtggaaaagttaaattccaatttgctattatttattcttagaaaa
gaaggattcaaatggtttttgaatattttaaaagaaaataacaaaatagaggaatttgac
attccttatgaattttcctctatttgtggagtttgtggttccttattcaactctgcagaa
aaaataaactacttctatccttatatggaaaaatactataatgaaaattttaaagtatga

DBGET integrated database retrieval system