KEGG   Bacillus subtilis subsp. subtilis 168: BSU40180Help
Entry
BSU40180          CDS       T00010                                 

Gene name
yydF
Definition
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3670
Motif
Other DBs
NCBI-GeneID: 937753
NCBI-ProteinID: NP_391898
Pasteur: BG11479
BSORF: BG11479
UniProt: Q45596
Position
complement(4127498..4127647)
Genome map
AA seq 49 aa AA seqDB search
MKKEITNNETVKNLEFKGLLDESQKLAKVNDLWYFVKSKENRWILGSGH
NT seq 150 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaggaaatcactaacaatgagactgtgaaaaacttagaatttaagggtctatta
gatgaatcacaaaagttagcaaaagtgaatgatctttggtattttgtaaaatcaaaagaa
aatcgctggattcttggaagtggtcattaa

DBGET integrated database retrieval system