KEGG   Bacillus subtilis subsp. subtilis 168: BSU40180
Entry
BSU40180          CDS       T00010                                 

Symbol
yydF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF3670
Other DBs
NCBI-GeneID: 937753
NCBI-ProteinID: NP_391898
Pasteur: BG11479
BSORF: BG11479
UniProt: Q45596 A0A6M4JR53
Position
complement(4127498..4127647)
AA seq 49 aa
MKKEITNNETVKNLEFKGLLDESQKLAKVNDLWYFVKSKENRWILGSGH
NT seq 150 nt   +upstreamnt  +downstreamnt
atgaaaaaggaaatcactaacaatgagactgtgaaaaacttagaatttaagggtctatta
gatgaatcacaaaagttagcaaaagtgaatgatctttggtattttgtaaaatcaaaagaa
aatcgctggattcttggaagtggtcattaa

DBGET integrated database retrieval system