KEGG   Bacillus subtilis subsp. subtilis 168: BSU40200
Entry
BSU40200          CDS       T00010                                 

Symbol
yydD
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: DUF2326 AAA_23 SMC_N
Other DBs
NCBI-GeneID: 937732
NCBI-ProteinID: NP_391900
Pasteur: BG11477
BSORF: BG11477
UniProt: Q45598 A0A6M3ZHZ2
Position
complement(4130578..4132338)
AA seq 586 aa
MIVMIIKNLFVCNSQEILKEYKFNAVGVNIILGEKREDHEETNGVGKSTMIECISFLLGK
TISNFYTTNEILLNKNVFIVLNVEIDGNQVFLARSFNSPKHGYTLHDTSLTFNLEEWKKV
SISVYKKFIEKEILKGEKEDITFAALREYIIRDEKTGFNDIVLPNRGGLKQYKLLNYLFT
LPTHTEKNIKVFRDKIEKLNSEIKLIESMNINIGDLKVKEDELINEIEDYNRVIYQTKTA
NKYNNDTNRYSEIKSELNKIQNEIFENEHICKQYQRNIDDLNKKVTKIKELENIEKFYED
IVGFFPEEVKQNYNKVQEFYNFMVESRGSYFKDKIVKIQADLKKLNIKKQGLTEQLESSA
RILKSNNFIEDISIVMEEQRRKEIELAEVRLRISDYDKKNHIFDKINELQHEILRVNSMY
YDEFQSYSAIVSELKKLFNNLMDVTYNQHGFLDFEYDNRISNAKQSTTGRIKISCSIPDE
RSHGRLHMKINIFDLTWFLYRCINKCSLNILIHDGSYSNPDPHVKGTLLKHINSSLLENR
IGQYFVTINKNELLLDDLQELESKGMIVAKLDRNNEDKNRFFGFRF
NT seq 1761 nt   +upstreamnt  +downstreamnt
gtgattgttatgattataaaaaatctttttgtttgcaattcccaagaaattttgaaagag
tataaatttaatgctgtaggagtaaatataatacttggtgaaaagagagaagatcatgaa
gagactaatggtgtaggtaagtcaacgatgattgaatgcatctcctttttactagggaag
actatatcaaatttttatacgacaaatgaaattcttctcaataaaaacgtttttattgtt
ttgaatgtggaaattgatggaaatcaagtattccttgctagatcttttaattctcctaaa
catggttatacattacatgatacttctttaacttttaatttggaggaatggaaaaaagtt
agtataagtgtatataaaaaatttattgaaaaggaaattttaaagggtgagaaagaggat
ataacttttgcggcgttaagggagtatattataagagacgaaaagacagggtttaatgat
atagttttaccgaataggggagggttaaaacaatataaattacttaactatctttttact
ttaccaactcatacagaaaaaaacataaaggtttttcgggataagattgaaaaattaaat
agtgaaataaaattgattgaatcaatgaatattaacattggcgatttaaaagttaaggaa
gatgaattaataaatgagatagaggattacaatagagttatctatcaaactaagactgcc
aataaatataataatgatacaaataggtactcagaaattaaaagtgaacttaataaaata
caaaatgaaatatttgaaaatgaacatatttgtaaacaatatcaaagaaatatagatgat
ttaaataaaaaagtaactaagattaaagaattagaaaatatagaaaaattctatgaagat
attgtaggtttttttccagaggaagtaaaacagaattataataaagtccaagagttctat
aatttcatggtagaaagtagagggagttattttaaagataaaattgttaaaatacaagcc
gatttaaaaaaacttaatatcaaaaagcaaggattaacagaacaactggaatcaagtgcc
agaattttaaagagtaacaatttcattgaggatatttccattgtgatggaagaacaaaga
aggaaagaaatagagttagcggaagtaagattgagaattagtgactacgataaaaaaaac
catatttttgataagattaatgaacttcaacatgaaatattaagagttaattcaatgtat
tatgatgagtttcaatcttatagcgctatagttagtgagttaaagaagctttttaataat
ctaatggatgttacatacaaccaacatggatttttagattttgaatatgataatagaata
agtaacgcaaaacaatcaactacaggaaggatcaaaatttcttgttctataccggatgaa
cgttcacatggtagactccatatgaagataaatatatttgatcttacttggtttttatac
aggtgtataaataagtgtagtttgaatattttaattcatgacggatcttattctaatcct
gatcctcatgtaaaaggtacattattaaaacatatcaattcaagtctgttagagaatagg
atcggacaatattttgtaacaataaataaaaatgaattattattagatgaccttcaagaa
ttagagtcgaaaggtatgattgttgcaaaattagatagaaacaatgaagataaaaataga
ttttttggttttagattttga

DBGET integrated database retrieval system