KEGG   Bacillus subtilis subsp. subtilis 168: BSU40220
Entry
BSU40220          CDS       T00010                                 

Symbol
yydB
Name
(RefSeq) metallophosphoesterase
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: Metallophos CTD11 Paramyx_P_V_C
Other DBs
NCBI-GeneID: 937728
NCBI-ProteinID: NP_391902
Pasteur: BG11475
BSORF: BG11475
UniProt: Q45600 A0A6M3ZI39
Position
complement(4132729..4134174)
AA seq 481 aa
MKVRFLQISDLHFQFQNYDTIVMRDKLLDFIEVLRRESDFDFLLLTGDIAHKGDVYNEDV
KEYLNGIIKSMGLSKNNVHLVPGNHDISRDMTRTLLIDSIMKSPNPSEMLDKLDQKATNI
LVEGQRKFFDFYEDFMGVKYPEEDLHFLYQSEKYNVLSINTCLLSDKKGEEGTLLTAQMK
LYKAIRKMNKEKNKGKVLNIAIGHHTLGCIESSERESIKAHFDDYFIDLYLAGHVHDSSF
NITANTNENPFLELVSGAIIKDEYATPEFISVDVNLDNGETEVTYYIWNTEYKYWSKNNQ
GGRRLQEGKLNYKINRLESLIEKEIEDNDDKIDEDEFKSFIIDFHEYRESYKTFTSNFDN
QIGLDKKFYDMKSGETFKRKFDSYSEYFGVINHIMDSTSYVSADKKELIAETIVDKYLEF
HNQYNNGDEIFVKIVNEIYLECHSVLPYSKALTKKYIKILTCWCIYECEIFNDNKRSVKN
D
NT seq 1446 nt   +upstreamnt  +downstreamnt
ttgaaggtacgttttttacaaatttctgatttgcattttcagtttcaaaattatgacact
attgtaatgagagataaattattagattttatagaagttttaagaagagagtcagatttt
gattttttattattaactggagatatagcacacaaaggtgatgtgtataacgaagatgtt
aaagaatatcttaatggaattattaaaagtatgggattaagtaagaataacgtacactta
gtgccaggaaatcacgatatatctagagacatgacgaggacacttttgattgatagtatt
atgaaatctcctaacccctcagaaatgttggataaactagatcaaaaagctacaaatata
ttagtggaaggtcaaaggaaatttttcgatttttatgaagattttatgggtgttaaatat
ccggaagaagatttgcattttttgtatcaatcggagaagtataatgttttatcaataaat
acatgtctgttatcagataaaaaaggtgaagaaggaacgttattaactgcacagatgaaa
ttatataaagcaataaggaagatgaacaaagagaaaaataagggcaaggtattaaatata
gctattgggcaccatacgttaggttgtattgaatcttccgaaagagaatcaataaaggca
cattttgatgattactttattgatctatatttggcaggacatgtacatgattcttcattt
aatattactgcaaatacaaatgaaaatccattcttagaattagtaagtggagccattata
aaggatgagtatgctactccagaatttatttcggtggatgtgaatttagataatggcgag
acagaagtaacatactacatttggaataccgaatataaatactggtcaaaaaacaaccaa
ggaggaaggagactacaggaagggaagttaaattataagattaatagattagagagcctt
attgaaaaagaaatagaagataacgatgataaaattgatgaagatgagtttaagagcttt
attatagattttcatgagtatagagaaagttataaaacatttactagtaattttgataat
caaattggtttagataaaaaattttatgatatgaaaagtggggaaacttttaaacggaaa
ttcgatagttattctgagtattttggtgtgataaaccatataatggattccacttcgtat
gtaagtgctgataaaaaggaattgattgctgagacgatagtagacaaatatctagagttt
cataatcaatataataatggagatgagatatttgtaaaaattgttaatgagatttatcta
gaatgtcattcagttttaccatattcaaaggctttaacgaaaaaatacattaagatttta
acatgttggtgcatttatgaatgtgagatttttaatgataacaaaagaagtgttaagaat
gattga

DBGET integrated database retrieval system