KEGG   Bacillus subtilis subsp. subtilis 168: BSU40230
Entry
BSU40230          CDS       T00010                                 

Symbol
yydA
Name
(RefSeq) 23S rRNA (pseudouridine(1915)-N(3))-methyltransferase RlmH
  KO
K00783  23S rRNA (pseudouridine1915-N3)-methyltransferase [EC:2.1.1.177]
Organism
bsu  Bacillus subtilis subsp. subtilis 168
Brite
KEGG Orthology (KO) [BR:bsu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:bsu03009]
    BSU40230 (yydA)
Enzymes [BR:bsu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.177  23S rRNA (pseudouridine1915-N3)-methyltransferase
     BSU40230 (yydA)
Ribosome biogenesis [BR:bsu03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    BSU40230 (yydA)
SSDB
Motif
Pfam: SPOUT_MTase
Other DBs
NCBI-GeneID: 937752
NCBI-ProteinID: NP_391903
Pasteur: BG11474
BSORF: BG11474
UniProt: Q45601 A0A6M3ZI42
Structure
Position
complement(4134436..4134915)
AA seq 159 aa
MNINIVTIGKLKEKYLKQGIEEYTKRLSAYAKIDIIELPDEKAPENLSDQDMKIIKDKEG
DRILSKISPDAHVIALAIEGKMKTSEELADTIDKLATYGKSKVTFVIGGSLGLSDTVMKR
ADEKLSFSKMTFPHQLMRLILVEQIYRAFRINRGEPYHK
NT seq 480 nt   +upstreamnt  +downstreamnt
gtgaatatcaatattgtgacaatcggaaaactaaaagaaaaatacctcaagcaaggcatt
gaagaatacaccaaacgactttcggcctacgcaaaaatcgacatcatcgaactcccggac
gaaaaagcgccggaaaacctaagcgaccaggacatgaaaatcataaaagacaaagaaggc
gaccgcatcctatccaaaatcagccccgacgcccacgtcatcgccctcgccatcgaagga
aaaatgaaaacatccgaagaactagccgatacaatagataagctggctacttatggaaaa
agcaaagtcaccttcgtcatcggcggatcactcggattgagtgacacggtgatgaagcga
gcggacgagaagctatcgttctcgaagatgacatttcctcatcagttgatgcggcttatt
ttagtggagcagatttatcgggcttttcggattaatcgtggggagccttatcataagtaa

DBGET integrated database retrieval system