KEGG   Bacillus subtilis subsp. subtilis 168: BSU40239
Entry
BSU40239          CDS       T00010                                 

Symbol
yyzF
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Motif
Pfam: YyzF
Other DBs
NCBI-GeneID: 8303139
NCBI-ProteinID: YP_003097800
UniProt: C0H3T9 A0A6M3ZKJ5
Position
complement(4134996..4135166)
AA seq 56 aa
MKQAYYSCEEHIETVLDMYIDDHELPPEIRKIEHTNSLSTACELCGDPAVYIVGNE
NT seq 171 nt   +upstreamnt  +downstreamnt
atgaaacaagcgtattattcttgtgaagaacacatcgaaacggtgctggatatgtacata
gacgaccacgagctgccgcccgaaatcagaaaaatcgaacatactaacagtttatccaca
gcctgtgaattatgtggagaccccgcagtatatatagtggggaacgaatga

DBGET integrated database retrieval system