KEGG   Bacillus subtilis subsp. subtilis 168: BSU40240
Entry
BSU40240          CDS       T00010                                 

Symbol
yycS
Name
(RefSeq) hypothetical protein
Organism
bsu  Bacillus subtilis subsp. subtilis 168
SSDB
Other DBs
NCBI-GeneID: 938490
NCBI-ProteinID: NP_391904
Pasteur: BG11472
BSORF: BG11472
UniProt: Q45603 A0A6M3ZII3
Position
4135351..4135764
AA seq 137 aa
MRFRWVWLFVIMLLLAECQPSYWVLEKDRIGEGSPDLEIYANYLQMHDDVKGYQVFTISE
GKKMVVVSLGSSEKDKKLEVSDVKFSSKETIVTVERKPAPTANEKNPFILIGLDKIEGDL
IVQDETGDRFEETDYQQ
NT seq 414 nt   +upstreamnt  +downstreamnt
ttgcgctttagatgggtttggctttttgtgattatgttgctgcttgctgagtgtcagcca
tcttattgggtgttggagaaggatcgaatcggtgaaggcagtccagacttagaaatatac
gctaattatctccaaatgcatgatgacgtgaaaggatatcaagtcttcaccatatcagaa
ggcaaaaaaatggtcgtcgtgtctctcggaagcagcgagaaagataagaagcttgaagtg
tcggacgtcaaattctcatctaaagaaacgattgtaactgtggagcgaaaacctgctcct
acggcaaatgagaaaaacccttttattttgattggactggacaaaattgaaggggattta
attgttcaagacgaaacaggagatcgctttgaagaaacggattaccagcaataa

DBGET integrated database retrieval system